PDB entry 3nzi

View 3nzi on RCSB PDB site
Description: substrate induced remodeling of the active site regulates htra1 activity
Deposited on 2010-07-16, released 2011-02-23
The last revision was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.202
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine protease HTRA1
    Species: Homo sapiens [TaxId:9606]
    Gene: HTRA1, HTRA, PRSS11
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: citrate synthase
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nziA (A:)
    mgqedpnslrhkynfiadvvekiapavvhielfrklpfskrevpvasgsgfivsedgliv
    tnahvvtnkhrvkvelkngatyeakikdvdekadialikidhqgklpvlllgrsselrpg
    efvvaigspfslqntvttgivsttqrggkelglrnsdmdyiqtdaiinygnsggplvnld
    gevigintlkvtagisfaipsdkikkflteshdrqakgkaitkkkyigirmmsltsskak
    elkdrhrdfpdvisgayiievipdtpaeagglkendviisingqsvvsandvsdvikres
    tlnmvvrrgnedimitvipeeidprslehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nziA (A:)
    edpnslrhkynfiadvvekiapavvhielfrklpfskrevpvasgsgfivsedglivtna
    hvvtnkhrvkvelkngatyeakikdvdekadialikidhqgklpvlllgrsselrpgefv
    vaigspfslqntvttgivsttqrggkelglrnsdmdyiqtdaiinygnsggplvnldgev
    igintlkvtagisfaipsdkikkflteshdr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nziB (B:)
    dpmfklv
    

    Sequence, based on observed residues (ATOM records):
    >3nziB (B:)
    mfklv