PDB entry 3nzh

View 3nzh on RCSB PDB site
Description: Crystal structure of anti-emmprin antibody 5F6 FAB
Class: immune system
Keywords: immunoglobulin fold, IMMUNE SYSTEM
Deposited on 2010-07-16, released 2011-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-27, with a file datestamp of 2011-07-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.197
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: 5f6 heavy chain
    Species: HOMO SAPIENS, MUS MUSCULUS [TaxId:9606, 10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NZH
  • Chain 'L':
    Compound: 5f6 light chain
    Species: HOMO SAPIENS, MUS MUSCULUS [TaxId:9606, 10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NZH (0-213)
    Domains in SCOPe 2.07: d3nzhl1, d3nzhl2
  • Heterogens: GOL, CO, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nzhL (L:)
    sivmtqtpkfllvsagdrvtitckasqsvsndvawyqqkpgqspklliyyasnrytgvpd
    rftgsgygtdftftistvqaedlavyfcqqdysspytfgggtkleikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec