PDB entry 3nza

View 3nza on RCSB PDB site
Description: Structural Analysis of Pneumocystis carinii and Human DHFR Complexes with NADPH and a Series of Five Potent 5-(omega-Carboxy(alkyloxy)pyrido[2,3-d]pyrimidine Derivatives
Class: oxidoreductase/oxidoreductase inhibitor
Keywords: pneumocystsis carinii dihydrofolare reductase inhibitor complexes, OXIDOREDUCTASE, OXIDOREDUCTASE-OXIDOREDUCTASE INHIBITOR complex
Deposited on 2010-07-16, released 2010-12-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Compound: dihydrofolate reductase
  Species: Pneumocystis carinii [TaxId:4754]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16184 (0-205)
  Domains in SCOPe 2.07: d3nzax_
• Heterogens: NDP, D2K, CL, HOH

PDB Chain Sequences:

• Chain 'X':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3nzaX (X:)
  mnqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrk
  twesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinri
  fviggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdlesw
  vgtkvphgkinedgfdyefemwtrdl