PDB entry 3nz8

View 3nz8 on RCSB PDB site
Description: Crystal structure of the HIV-2 neutralizing Fab fragment 7C8
Class: immune system
Keywords: Antigen binding, Antibody, Fab, Immunological, HIV-2, V3, gp125, IMMUNE SYSTEM
Deposited on 2010-07-16, released 2011-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mouse anti V3 antibody 7C8 Fab, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NZ8 (0-220)
    Domains in SCOPe 2.08: d3nz8a_
  • Chain 'B':
    Compound: Mouse anti V3 antibody 7C8 Fab, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NZ8 (0-End)
    Domains in SCOPe 2.08: d3nz8b1, d3nz8b2
  • Chain 'H':
    Compound: Mouse anti V3 antibody 7C8 Fab, heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NZ8 (0-220)
    Domains in SCOPe 2.08: d3nz8h_
  • Chain 'L':
    Compound: Mouse anti V3 antibody 7C8 Fab, light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NZ8 (0-217)
    Domains in SCOPe 2.08: d3nz8l1, d3nz8l2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nz8A (A:)
    avqleesgpelvkpgalvkisckasgytfttydinwvkqrpgqglewigwiypgdgsnky
    nekfkdkatltvdkssstaymhlssltsensavyfcargygknvyamdywgqgtsvtvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nz8A (A:)
    avqleesgpelvkpgalvkisckasgytfttydinwvkqrpgqglewigwiypgdgsnky
    nekfkdkatltvdkssstaymhlssltsensavyfcargygknvyamdywgqgtsvtvss
    akttppsvyplapgtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nz8B (B:)
    dvvmtqtplslpvslgdqasiscrssqtivhsngytyldwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpftfgsgtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nz8B (B:)
    dvvmtqtplslpvslgdqasiscrssqtivhsngytyldwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpftfgsgtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrn
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3nz8H (H:)
    avqleesgpelvkpgalvkisckasgytfttydinwvkqrpgqglewigwiypgdgsnky
    nekfkdkatltvdkssstaymhlssltsensavyfcargygknvyamdywgqgtsvtvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nz8H (H:)
    avqleesgpelvkpgalvkisckasgytfttydinwvkqrpgqglewigwiypgdgsnky
    nekfkdkatltvdkssstaymhlssltsensavyfcargygknvyamdywgqgtsvtvss
    akttppsvyplapgtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nz8L (L:)
    dvvmtqtplslpvslgdqasiscrssqtivhsngytyldwylqkpgqspklliykvsnrf
    sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpftfgsgtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnrne