PDB entry 3nz4

View 3nz4 on RCSB PDB site
Description: Crystal Structure of a Taxus Phenylalanine Aminomutase
Class: lyase
Keywords: Aminomutase, Taxol biosynthetic pathway, MIO, phenylalanine, LYASE
Deposited on 2010-07-16, released 2011-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 2.38 Å
R-factor: 0.189
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phenylalanine ammonia-lyase
    Species: Taxus canadensis [TaxId:88032]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6GZ04
      • conflict (127)
      • conflict (195)
      • conflict (472)
      • conflict (555)
      • conflict (633)
    Domains in SCOPe 2.07: d3nz4a_
  • Chain 'B':
    Compound: phenylalanine ammonia-lyase
    Species: Taxus canadensis [TaxId:88032]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6GZ04
      • conflict (127)
      • conflict (195)
      • conflict (472)
      • conflict (555)
      • conflict (633)
    Domains in SCOPe 2.07: d3nz4b_
  • Heterogens: TCA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nz4A (A:)
    mgfavesrshvkdilglintfnevkkitvdgttpitvahvaalarrhdvkvaleaeqcra
    rvetcsswvqrkaedgadiygvttgfgacssrrtnqlselqeslircllagvftkgcass
    vdelpatvtrsamllrlnsftygcsgirwevmealekllnsnvspkvplrgsvsasgdli
    playiaglligkpsviarigddvevpapealsrvglrpfklqakeglalvngtsfatala
    stvmydanvllllvetlcgmfcevifgreefahplihkvkphpgqiesaellewllrssp
    fqdlsreyysidklkkpkqdryalrsspqwlaplvqtirdatttvetevnsandnpiidh
    andralhganfqgsavgfymdyvriavaglgkllfaqftelmieyysnglpgnlslgpdl
    svdyglkgldiamaaysselqylanpvtthvhsaeqhnqdinslalisarktdealdilk
    lmiashltamcqavdlrqleealvkvvenvvstladecglpndtkarllyvakavpvyty
    lespcdptlplllglkqscfgsilalhkkdgietdtlvdrlaefekrlsdrlenemtavr
    vlyekkghktadnndalvriqgsrflpfyrfvrdeldtgvmsarreqtpqedvqkvfdai
    adgritvpllhclqgflgqpngcangvesfqsvwnksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nz4A (A:)
    srshvkdilglintfnevkkitvdgttpitvahvaalarrhdvkvaleaeqcrarvetcs
    swvqrkaedgadiygvttgfgacssrrtnqlselqeslircllagvftkgcassvdelpa
    tvtrsamllrlnsftygcsgirwevmealekllnsnvspkvplrgsvsasgdliplayia
    glligkpsviarigddvevpapealsrvglrpfklqakeglalvngtsfatalastvmyd
    anvllllvetlcgmfcevifgreefahplihkvkphpgqiesaellewllrsspfqdlsr
    eyysidklkkpkqdryalrsspqwlaplvqtirdatttvetevnsandnpiidhandral
    hganfqgsavgfymdyvriavaglgkllfaqftelmieyysnglpgnlslgpdlsvdygl
    kgldiamaaysselqylanpvtthvhsaeqhnqdinslalisarktdealdilklmiash
    ltamcqavdlrqleealvkvvenvvstladecglpndtkarllyvakavpvytylespcd
    ptlplllglkqscfgsilalhketdtlvdrlaefekrlsdrlenemtavrvlyekvriqg
    srflpfyrfvrdeldtgvmsarreqtpqedvqkvfdaiadgritvpllhclqgflg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nz4B (B:)
    mgfavesrshvkdilglintfnevkkitvdgttpitvahvaalarrhdvkvaleaeqcra
    rvetcsswvqrkaedgadiygvttgfgacssrrtnqlselqeslircllagvftkgcass
    vdelpatvtrsamllrlnsftygcsgirwevmealekllnsnvspkvplrgsvsasgdli
    playiaglligkpsviarigddvevpapealsrvglrpfklqakeglalvngtsfatala
    stvmydanvllllvetlcgmfcevifgreefahplihkvkphpgqiesaellewllrssp
    fqdlsreyysidklkkpkqdryalrsspqwlaplvqtirdatttvetevnsandnpiidh
    andralhganfqgsavgfymdyvriavaglgkllfaqftelmieyysnglpgnlslgpdl
    svdyglkgldiamaaysselqylanpvtthvhsaeqhnqdinslalisarktdealdilk
    lmiashltamcqavdlrqleealvkvvenvvstladecglpndtkarllyvakavpvyty
    lespcdptlplllglkqscfgsilalhkkdgietdtlvdrlaefekrlsdrlenemtavr
    vlyekkghktadnndalvriqgsrflpfyrfvrdeldtgvmsarreqtpqedvqkvfdai
    adgritvpllhclqgflgqpngcangvesfqsvwnksa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nz4B (B:)
    srshvkdilglintfnevkkitvdgttpitvahvaalarrhdvkvaleaeqcrarvetcs
    swvqrkaedgadiygvttgfgacssrrtnqlselqeslircllagvftkgcassvdelpa
    tvtrsamllrlnsftygcsgirwevmealekllnsnvspkvplrgsvsasgdliplayia
    glligkpsviarigddvevpapealsrvglrpfklqakeglalvngtsfatalastvmyd
    anvllllvetlcgmfcevifgreefahplihkvkphpgqiesaellewllrsspfqdlsr
    eyysidklkkpkqdryalrsspqwlaplvqtirdatttvetevnsandnpiidhandral
    hganfqgsavgfymdyvriavaglgkllfaqftelmieyysnglpgnlslgpdlsvdygl
    kgldiamaaysselqylanpvtthvhsaeqhnqdinslalisarktdealdilklmiash
    ltamcqavdlrqleealvkvvenvvstladecglpndtkarllyvakavpvytylespcd
    ptlplllglkqscfgsilalhkkietdtlvdrlaefekrlsdrlenemtavrvlyekvri
    qgsrflpfyrfvrdeldtgvmsarreqtpqedvqkvfdaiadgritvpllhclqgflg