PDB entry 3nz3

View 3nz3 on RCSB PDB site
Description: Crystal structure of the mucin-binding domain of Spr1345 from Streptococcus pneumoniae
Deposited on 2010-07-15, released 2011-04-20
The last revision was dated 2011-04-20, with a file datestamp of 2011-04-15.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.213
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein
    Species: Streptococcus pneumoniae [TaxId:171101]
    Gene: spr1345
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PGE, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nz3A (A:)
    mghhhhhhvvpktatstetktitriihyvdkvtnqnvkedvvqpvtlsrtktenkvtgvv
    tygewttgnwdevisgkidkykdpdiptvesqevtsdssdkeitvrydrlst
    

    Sequence, based on observed residues (ATOM records):
    >3nz3A (A:)
    tatstetktitriihyvdkvtnqnvkedvvqpvtlsrtktenkvtgvvtygewttgnwde
    visgkidkykdpdiptvesqevtsdssdkeitvrydrlst