PDB entry 3nz2

View 3nz2 on RCSB PDB site
Description: Crystal Structure of Hexapeptide-Repeat containing-Acetyltransferase VCA0836 Complexed with Acetyl Co Enzyme A from Vibrio cholerae O1 biovar eltor
Class: transferase
Keywords: Structural Genomics, Center for Structural Genomics of Infectious Diseases, CSGID, beta-helix, methyltransferase, TRANSFERASE
Deposited on 2010-07-15, released 2010-08-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-04, with a file datestamp of 2010-07-30.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.191
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hexapeptide-repeat containing-acetyltransferase
    Species: Vibrio cholerae O1 biovar eltor [TaxId:243277]
    Gene: VC_A0836
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nz2a_
  • Chain 'B':
    Compound: Hexapeptide-repeat containing-acetyltransferase
    Species: Vibrio cholerae O1 biovar eltor [TaxId:243277]
    Gene: VC_A0836
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KLB0 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d3nz2b1, d3nz2b2
  • Chain 'C':
    Compound: Hexapeptide-repeat containing-acetyltransferase
    Species: Vibrio cholerae O1 biovar eltor [TaxId:243277]
    Gene: VC_A0836
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nz2c_
  • Chain 'D':
    Compound: Hexapeptide-repeat containing-acetyltransferase
    Species: Vibrio cholerae O1 biovar eltor [TaxId:243277]
    Gene: VC_A0836
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nz2d_
  • Chain 'E':
    Compound: Hexapeptide-repeat containing-acetyltransferase
    Species: Vibrio cholerae O1 biovar eltor [TaxId:243277]
    Gene: VC_A0836
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nz2e_
  • Chain 'F':
    Compound: Hexapeptide-repeat containing-acetyltransferase
    Species: Vibrio cholerae O1 biovar eltor [TaxId:243277]
    Gene: VC_A0836
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nz2f_
  • Chain 'G':
    Compound: Hexapeptide-repeat containing-acetyltransferase
    Species: Vibrio cholerae O1 biovar eltor [TaxId:243277]
    Gene: VC_A0836
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nz2g_
  • Chain 'H':
    Compound: Hexapeptide-repeat containing-acetyltransferase
    Species: Vibrio cholerae O1 biovar eltor [TaxId:243277]
    Gene: VC_A0836
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nz2h_
  • Chain 'I':
    Compound: Hexapeptide-repeat containing-acetyltransferase
    Species: Vibrio cholerae O1 biovar eltor [TaxId:243277]
    Gene: VC_A0836
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nz2i_
  • Chain 'J':
    Compound: Hexapeptide-repeat containing-acetyltransferase
    Species: Vibrio cholerae O1 biovar eltor [TaxId:243277]
    Gene: VC_A0836
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KLB0 (4-End)
      • expression tag (2-3)
    Domains in SCOPe 2.07: d3nz2j1, d3nz2j2
  • Chain 'K':
    Compound: Hexapeptide-repeat containing-acetyltransferase
    Species: Vibrio cholerae O1 biovar eltor [TaxId:243277]
    Gene: VC_A0836
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nz2k_
  • Chain 'L':
    Compound: Hexapeptide-repeat containing-acetyltransferase
    Species: Vibrio cholerae O1 biovar eltor [TaxId:243277]
    Gene: VC_A0836
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nz2l_
  • Heterogens: ACO, ACY, GOL, CL, MG, BU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nz2A (A:)
    snamkmselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlg
    hkscvqppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldy
    rrrqawetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtpa
    rilrslkdpaesmae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nz2A (A:)
    mselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlghkscv
    qppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldyrrrqa
    wetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtparilrs
    lk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nz2B (B:)
    snamkmselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlg
    hkscvqppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldy
    rrrqawetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtpa
    rilrslkdpaesmae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nz2B (B:)
    mkmselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlghks
    cvqppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldyrrr
    qawetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtparil
    rslk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nz2C (C:)
    snamkmselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlg
    hkscvqppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldy
    rrrqawetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtpa
    rilrslkdpaesmae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nz2C (C:)
    mselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlghkscv
    qppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldyrrrqa
    wetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtparilrs
    lkd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nz2D (D:)
    snamkmselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlg
    hkscvqppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldy
    rrrqawetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtpa
    rilrslkdpaesmae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nz2D (D:)
    mselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlghkscv
    qppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldyrrrqa
    wetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtparilrs
    lkd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3nz2E (E:)
    snamkmselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlg
    hkscvqppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldy
    rrrqawetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtpa
    rilrslkdpaesmae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nz2E (E:)
    mselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlghkscv
    qppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldyrrrqa
    wetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtparilrs
    lkd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3nz2F (F:)
    snamkmselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlg
    hkscvqppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldy
    rrrqawetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtpa
    rilrslkdpaesmae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nz2F (F:)
    mselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlghkscv
    qppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldyrrrqa
    wetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtparilrs
    lkd
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3nz2G (G:)
    snamkmselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlg
    hkscvqppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldy
    rrrqawetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtpa
    rilrslkdpaesmae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nz2G (G:)
    mselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlghkscv
    qppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldyrrrqa
    wetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtparilrs
    lk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3nz2H (H:)
    snamkmselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlg
    hkscvqppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldy
    rrrqawetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtpa
    rilrslkdpaesmae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nz2H (H:)
    mselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlghkscv
    qppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldyrrrqa
    wetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtparilrs
    lkd
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3nz2I (I:)
    snamkmselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlg
    hkscvqppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldy
    rrrqawetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtpa
    rilrslkdpaesmae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nz2I (I:)
    kmselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlghksc
    vqppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldyrrrq
    awetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtparilr
    slkd
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3nz2J (J:)
    snamkmselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlg
    hkscvqppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldy
    rrrqawetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtpa
    rilrslkdpaesmae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nz2J (J:)
    amkmselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlghk
    scvqppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldyrr
    rqawetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtpari
    lrslk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3nz2K (K:)
    snamkmselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlg
    hkscvqppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldy
    rrrqawetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtpa
    rilrslkdpaesmae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nz2K (K:)
    mselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlghkscv
    qppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldyrrrqa
    wetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtparilrs
    lkd
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3nz2L (L:)
    snamkmselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlg
    hkscvqppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldy
    rrrqawetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtpa
    rilrslkdpaesmae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nz2L (L:)
    mselekmlkgehfdgasaeiealrsqagrlkleinqsldeaeryalqrelfghlghkscv
    qppfhcefgktirigdhtfinmnvvmldgapitigdhvligpstqfytashsldyrrrqa
    wetickpivieddvwiggnvvinqgvtigarsvvaansvvnqdvppdtlvggtparilrs
    lkd