PDB entry 3nyz

View 3nyz on RCSB PDB site
Description: Crystal Structure of Kemp Elimination Catalyst 1A53-2
Class: Lyase
Keywords: Tim Barrel, Kemp Elimination Enzyme, Lyase
Deposited on 2010-07-15, released 2011-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-25, with a file datestamp of 2012-04-20.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: 0.203
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: indole-3-glycerol phosphate synthase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: INDOLE-3-GLYCEROLPHOSPHATE SYNTHASE, SSO0895, trpC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06121 (Start-247)
      • engineered mutation (50)
      • engineered mutation (80)
      • engineered mutation (82)
      • engineered mutation (109)
      • engineered mutation (130)
      • engineered mutation (156)
      • engineered mutation (158)
      • engineered mutation (177)
      • engineered mutation (179)
      • engineered mutation (209-210)
      • engineered mutation (230)
    Domains in SCOPe 2.07: d3nyza_
  • Chain 'B':
    Compound: indole-3-glycerol phosphate synthase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Gene: INDOLE-3-GLYCEROLPHOSPHATE SYNTHASE, SSO0895, trpC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q06121 (Start-247)
      • engineered mutation (50)
      • engineered mutation (80)
      • engineered mutation (82)
      • engineered mutation (109)
      • engineered mutation (130)
      • engineered mutation (156)
      • engineered mutation (158)
      • engineered mutation (177)
      • engineered mutation (179)
      • engineered mutation (209-210)
      • engineered mutation (230)
    Domains in SCOPe 2.07: d3nyzb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nyzA (A:)
    mprylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiaaykrkspsgl
    dverdpieyskfmeryavglaiateekyfngsyetlrkiassvsipilmwdfivkesqid
    daynlgadtvalivkiltereleslleyarsygmepaivindendldialrigarfieia
    srdletleinkenqrklismipsnvvkvawqgiserneieelrklgvnafgigsslmrnp
    ekikefilgsiegrghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nyzA (A:)
    prylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiaaykrkspsgld
    verdpieyskfmeryavglaiateekyfngsyetlrkiassvsipilmwdfivkesqidd
    aynlgadtvalivkiltereleslleyarsygmepaivindendldialrigarfieias
    rdletleinkenqrklismipsnvvkvawqgiserneieelrklgvnafgigsslmrnpe
    kikefil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nyzB (B:)
    mprylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiaaykrkspsgl
    dverdpieyskfmeryavglaiateekyfngsyetlrkiassvsipilmwdfivkesqid
    daynlgadtvalivkiltereleslleyarsygmepaivindendldialrigarfieia
    srdletleinkenqrklismipsnvvkvawqgiserneieelrklgvnafgigsslmrnp
    ekikefilgsiegrghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nyzB (B:)
    prylkgwlkdvvqlslrrpsfrasrqrpiislnerilefnkrnitaiiaaykrkspsgld
    verdpieyskfmeryavglaiateekyfngsyetlrkiassvsipilmwdfivkesqidd
    aynlgadtvalivkiltereleslleyarsygmepaivindendldialrigarfieias
    rdletleinkenqrklismipsnvvkvawqgiserneieelrklgvnafgigsslmrnpe
    kikefil