PDB entry 3nyy

View 3nyy on RCSB PDB site
Description: Crystal structure of a putative glycyl-glycine endopeptidase lytM (RUMGNA_02482) from Ruminococcus gnavus ATCC 29149 at 1.60 A resolution
Deposited on 2010-07-15, released 2010-09-15
The last revision was dated 2011-07-20, with a file datestamp of 2011-07-15.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.15
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative glycyl-glycine endopeptidase lytM
    Species: Ruminococcus gnavus [TaxId:411470]
    Gene: RUMGNA_02482
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7B4J8 (1-End)
      • leader sequence (0)
  • Heterogens: 2PE, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nyyA (A:)
    gvsgfqrlqkpvvsqpdfrrqpvsetmqvylkqaadpgrdvglywmatdfenrrfpgkvs
    psgfqklyrqwrnqtgwdayvqscraiwndvkyfpipqslddtedkisyvdswmfernyg
    gkrghegtdimaekntpgyypvvsmtdgvvtekgwlekggwrigitaptgayfyyahlds
    yaelekgdpvkagdllgymgdsgygeegttgefpvhlhlgiylkegteeisvnpypvlry
    aenarikcvysr
    

    Sequence, based on observed residues (ATOM records):
    >3nyyA (A:)
    gvsgfqrlqkpvvsqpdfrrqpvsetmqvylkqaadpgrdvglywmatdfenrrfpgkvs
    psgfqklyrqwrnqtgwdayvqscraiwndvkyfpipqslddtedkisyvdswmfernyg
    gkrghegtdimaekntpgyypvvsmtdgvvtekgwlekggwrigitaptgayfyyahlds
    yaelekgdpvkagdllgymgdsgygeegttgefpvhlhlgiylkegteeisvnpypvlry
    aenarikcvys