PDB entry 3nyx

View 3nyx on RCSB PDB site
Description: Non-phosphorylated TYK2 JH1 domain with Quinoline-Thiadiazole-Thiophene Inhibitor
Class: transferase/transferase inhibitor
Keywords: protein kinase, tyrosine phosphorylation, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2010-07-15, released 2010-10-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.219
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-receptor tyrosine-protein kinase TYK2
    Species: Homo sapiens [TaxId:9606]
    Gene: TYK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29597 (Start-294)
      • conflict (134)
      • engineered mutation (141)
      • expression tag (295-296)
    Domains in SCOPe 2.07: d3nyxa1, d3nyxa2
  • Heterogens: TZ1, DTT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nyxA (A:)
    mgspasdptvfhkrylkkirdlgeghfgkvslycydptndgtgemvavkalkadcgpqhr
    sgwkqeidilrtlyhehiikykgccedqgekslqlvmeyvplgslrdylprhsiglaqll
    lfaqqicegmaylhsqhyihrnlaarnvlldndrlvkigdfglakavpegheyyrvredg
    dspvfwyapeclkeykfyyasdvwsfgvtlyellthcdssqspptkfleligiaqgqmtv
    lrltellergerlprpdkcpcevyhlmkncweteasfrptfenlipilktvhekyrhhhh
    hh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nyxA (A:)
    ptvfhkrylkkirdlgeghfgkvslycydptndgemvavkalkadcgpqhrsgwkqeidi
    lrtlyhehiikykgccedqekslqlvmeyvplgslrdylprhsiglaqlllfaqqicegm
    aylhsqhyihrnlaarnvlldndrlvkigdfglakavpegheyyrvredgdspvfwyape
    clkeykfyyasdvwsfgvtlyellthcdssqspptkfleligiaqgqmtvlrltellerg
    erlprpdkcpcevyhlmkncweteasfrptfenlipilktvhekyrh