PDB entry 3nyv

View 3nyv on RCSB PDB site
Description: calcium-dependent protein kinase 1 from toxoplasma gondii (tgcdpk1) in complex with non-specific inhibitor whi-p180
Deposited on 2010-07-15, released 2010-07-28
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Calmodulin-domain protein kinase 1
    Species: Toxoplasma gondii [TaxId:5811]
    Gene: AAG53993, CDPK1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: DTQ, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nyvA (A:)
    gpgsmmdhlhatpgmfvqhstaifsdrykgqrvlgkgsfgevilckdkitgqecavkvis
    krqvkqktdkesllrevqllkqldhpnimklyeffedkgyfylvgevytggelfdeiisr
    krfsevdaariirqvlsgitymhknkivhrdlkpenllleskskdaniriidfglsthfe
    askkmkdkigtayyiapevlhgtydekcdvwstgvilyillsgcppfnganeydilkkve
    kgkytfelpqwkkvsesakdlirkmltyvpsmrisardaldhewiqtytkeqisvdvpsl
    dnailnirqfqgtqklaqaallymgskltsqdetkeltaifhkmdkngdgqldraelieg
    ykelmrmkgqdasmldasavehevdqvldavdfdkngyieysefvtvamdrktllsrerl
    erafrmfdsdnsgkisstelatifgvsdvdsetwksvlsevdknndgevdfdefqqmllk
    lcgn
    

    Sequence, based on observed residues (ATOM records):
    >3nyvA (A:)
    hstaifsdrykgqrvlgkgsfgevilckdkitgqecavkviskrqvkqktdkesllrevq
    llkqldhpnimklyeffedkgyfylvgevytggelfdeiisrkrfsevdaariirqvlsg
    itymhknkivhrdlkpenllleskskdaniriidfglsthfeaskkmkdkigtayyiape
    vlhgtydekcdvwstgvilyillsgcppfnganeydilkkvekgkytfelpqwkkvsesa
    kdlirkmltyvpsmrisardaldhewiqtytkdvpsldnailnirqfqgtqklaqaally
    mgskltsqdetkeltaifhkmdkngdgqldraeliegykelmrdasmldasavehevdqv
    ldavdfdkngyieysefvtvamdrktllsrerlerafrmfdsdnsgkisstelatifgvs
    dvdsetwksvlsevdknndgevdfdefqqmllklcgn