PDB entry 3nyu

View 3nyu on RCSB PDB site
Description: X-ray crystal structure of the Wbpe (WlbE) aminotransferase from pseudomonas aeruginosa as the PLP internal aldimine adduct with lysine 185
Class: transferase
Keywords: aminotransferase, PLP binding, nucleotide-sugar binding, TRANSFERASE
Deposited on 2010-07-15, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminotransferase WbpE
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA3155, wbpE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nyua_
  • Chain 'B':
    Compound: Aminotransferase WbpE
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA3155, wbpE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nyub_
  • Chain 'C':
    Compound: Aminotransferase WbpE
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA3155, wbpE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nyuc_
  • Chain 'D':
    Compound: Aminotransferase WbpE
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA3155, wbpE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nyud_
  • Heterogens: EDO, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nyuA (A:)
    miefidlknqqarikdkidagiqrvlrhgqyilgpevteledrladfvgakyciscangt
    dalqivqmalgvgpgdevitpgftyvataetvallgakpvyvdidprtynldpqlleaai
    tprtkaiipvslygqcadfdainaiaskygipviedaaqsfgasykgkrscnlstvacts
    ffpskplgcygdggaiftnddelatairqiarhgqdrryhhirvgvnsrldtlqaaillp
    kleifeeeialrqkvaaeydlslkqvgigtpfievnnisvyaqytvrmdnresvqaslka
    agvptavhypiplnkqpavadekaklpvgdkaatqvmslpmhpyldtasikiicaaltnl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nyuA (A:)
    miefidlknqqarikdkidagiqrvlrhgqyilgpevteledrladfvgakyciscangt
    dalqivqmalgvgpgdevitpgftyvataetvallgakpvyvdidprtynldpqlleaai
    tprtkaiipvslygqcadfdainaiaskygipviedaaqsfgasykgkrscnlstvacts
    ffpskplgcygdggaiftnddelatairqiarhgqdrryhhirvgvnsrldtlqaaillp
    kleifeeeialrqkvaaeydlslkqvgigtpfievnnisvyaqytvrmdnresvqaslka
    agvptavhypiplnkqpavadekaklpvgdkaatqvmslpmhpyldtasikiicaaltn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nyuB (B:)
    miefidlknqqarikdkidagiqrvlrhgqyilgpevteledrladfvgakyciscangt
    dalqivqmalgvgpgdevitpgftyvataetvallgakpvyvdidprtynldpqlleaai
    tprtkaiipvslygqcadfdainaiaskygipviedaaqsfgasykgkrscnlstvacts
    ffpskplgcygdggaiftnddelatairqiarhgqdrryhhirvgvnsrldtlqaaillp
    kleifeeeialrqkvaaeydlslkqvgigtpfievnnisvyaqytvrmdnresvqaslka
    agvptavhypiplnkqpavadekaklpvgdkaatqvmslpmhpyldtasikiicaaltnl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nyuB (B:)
    iefidlknqqarikdkidagiqrvlrhgqyilgpevteledrladfvgakyciscangtd
    alqivqmalgvgpgdevitpgftyvataetvallgakpvyvdidprtynldpqlleaait
    prtkaiipvslygqcadfdainaiaskygipviedaaqsfgasykgkrscnlstvactsf
    fpskplgcygdggaiftnddelatairqiarhgqdrryhhirvgvnsrldtlqaaillpk
    leifeeeialrqkvaaeydlslkqvgigtpfievnnisvyaqytvrmdnresvqaslkaa
    gvptavhypiplnkqpavadekaklpvgdkaatqvmslpmhpyldtasikiicaalt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nyuC (C:)
    miefidlknqqarikdkidagiqrvlrhgqyilgpevteledrladfvgakyciscangt
    dalqivqmalgvgpgdevitpgftyvataetvallgakpvyvdidprtynldpqlleaai
    tprtkaiipvslygqcadfdainaiaskygipviedaaqsfgasykgkrscnlstvacts
    ffpskplgcygdggaiftnddelatairqiarhgqdrryhhirvgvnsrldtlqaaillp
    kleifeeeialrqkvaaeydlslkqvgigtpfievnnisvyaqytvrmdnresvqaslka
    agvptavhypiplnkqpavadekaklpvgdkaatqvmslpmhpyldtasikiicaaltnl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nyuC (C:)
    iefidlknqqarikdkidagiqrvlrhgqyilgpevteledrladfvgakyciscangtd
    alqivqmalgvgpgdevitpgftyvataetvallgakpvyvdidprtynldpqlleaait
    prtkaiipvslygqcadfdainaiaskygipviedaaqsfgasykgkrscnlstvactsf
    fpskplgcygdggaiftnddelatairqiarhgqdrryhhirvgvnsrldtlqaaillpk
    leifeeeialrqkvaaeydlslkqvgigtpfievnnisvyaqytvrmdnresvqaslkaa
    gvptavhypiplnkqpavadekaklpvgdkaatqvmslpmhpyldtasikiicaalt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nyuD (D:)
    miefidlknqqarikdkidagiqrvlrhgqyilgpevteledrladfvgakyciscangt
    dalqivqmalgvgpgdevitpgftyvataetvallgakpvyvdidprtynldpqlleaai
    tprtkaiipvslygqcadfdainaiaskygipviedaaqsfgasykgkrscnlstvacts
    ffpskplgcygdggaiftnddelatairqiarhgqdrryhhirvgvnsrldtlqaaillp
    kleifeeeialrqkvaaeydlslkqvgigtpfievnnisvyaqytvrmdnresvqaslka
    agvptavhypiplnkqpavadekaklpvgdkaatqvmslpmhpyldtasikiicaaltnl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nyuD (D:)
    iefidlknqqarikdkidagiqrvlrhgqyilgpevteledrladfvgakyciscangtd
    alqivqmalgvgpgdevitpgftyvataetvallgakpvyvdidprtynldpqlleaait
    prtkaiipvslygqcadfdainaiaskygipviedaaqsfgasykgkrscnlstvactsf
    fpskplgcygdggaiftnddelatairqiarhgqdrryhhirvgvnsrldtlqaaillpk
    leifeeeialrqkvaaeydlslkqvgigtpfievnnisvyaqytvrmdnresvqaslkaa
    gvptavhypiplnkqpavadekaklpvgdkaatqvmslpmhpyldtasikiicaalt