PDB entry 3nyt

View 3nyt on RCSB PDB site
Description: X-ray crystal structure of the WlbE (WpbE) aminotransferase from pseudomonas aeruginosa, mutation K185A, in complex with the PLP external aldimine adduct with UDP-3-amino-2-N-acetyl-glucuronic acid, at 1.3 angstrom resolution
Class: transferase
Keywords: aminotransferase, PLP binding, nucleotide-sugar binding, TRANSFERASE
Deposited on 2010-07-15, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminotransferase WbpE
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA3155, wbpE
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HZ76 (0-358)
      • engineered mutation (184)
    Domains in SCOPe 2.07: d3nyta_
  • Heterogens: ULP, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nytA (A:)
    miefidlknqqarikdkidagiqrvlrhgqyilgpevteledrladfvgakyciscangt
    dalqivqmalgvgpgdevitpgftyvataetvallgakpvyvdidprtynldpqlleaai
    tprtkaiipvslygqcadfdainaiaskygipviedaaqsfgasykgkrscnlstvacts
    ffpsaplgcygdggaiftnddelatairqiarhgqdrryhhirvgvnsrldtlqaaillp
    kleifeeeialrqkvaaeydlslkqvgigtpfievnnisvyaqytvrmdnresvqaslka
    agvptavhypiplnkqpavadekaklpvgdkaatqvmslpmhpyldtasikiicaaltnl
    ehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nytA (A:)
    miefidlknqqarikdkidagiqrvlrhgqyilgpevteledrladfvgakyciscangt
    dalqivqmalgvgpgdevitpgftyvataetvallgakpvyvdidprtynldpqlleaai
    tprtkaiipvslygqcadfdainaiaskygipviedaaqsfgasykgkrscnlstvacts
    ffpsaplgcygdggaiftnddelatairqiarhgqdrryhhirvgvnsrldtlqaaillp
    kleifeeeialrqkvaaeydlslkqvgigtpfievnnisvyaqytvrmdnresvqaslka
    agvptavhypiplnkqpavadekaklpvgdkaatqvmslpmhpyldtasikiicaaltn