PDB entry 3nyo

View 3nyo on RCSB PDB site
Description: Crystal Structure of G Protein-Coupled Receptor Kinase 6 in Complex with AMP
Deposited on 2010-07-15, released 2010-09-22
The last revision was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 2.92 Å
R-factor: 0.222
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: G protein-coupled receptor kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: GPRK6, GRK6
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: G protein-coupled receptor kinase 6
    Species: Homo sapiens [TaxId:9606]
    Gene: GPRK6, GRK6
    Database cross-references and differences (RAF-indexed):
  • Heterogens: AMP, SO4, BU3, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nyoA (A:)
    elenivantvllkareggggnrkgkskkwrqmlqfphisqceelrlslerdyhslcerqp
    igrllfrefcatrpelsrcvafldgvaeyevtpddkrkacgrqltqnflshtgpdlipev
    prqlvtnctqrleqgpckdlfqeltrltheylsvapfadyldsiyfnrflqwkwlerqpv
    tkntfrqyrvlgkggfgevcacqvratgkmyackklekkrikkrkgeamalnekqilekv
    nsrfvvslayayetkdalclvltlmnggdlkfhiyhmgqagfpearavfyaaeiccgled
    lhrerivyrdlkpenillddhghirisdlglavhvpegqtikgrvgtvgymapevvkner
    ytfspdwwalgcllyemiagqspfqqrkkkikreeverlvkevpeeyserfspqarslcs
    qllckdpaerlgcrggsarevkehplfkklnfkrlgagmleppfkpdpqaiyckdvldie
    qfstvkgveleptdqdfyqkfatgsvpipwqnemvetecfqelnvfgldgsvppdldwkg
    qppappkkgllqrlfsrqdccgncsdseeelptrl
    

    Sequence, based on observed residues (ATOM records):
    >3nyoA (A:)
    elenivantvllkareggggnrkgkskkwrqmlqfphisqceelrlslerdyhslcerqp
    igrllfrefcatrpelsrcvafldgvaeyevtpddkrkacgrqltqnflshtgpdlipev
    prqlvtnctqrleqgpckdlfqeltrltheylsvapfadyldsiyfnrflqwkwlerqpv
    tkntfrqyrvlgkggfgevcacqvratgkmyackklekkrikkrkgeamalnekqilekv
    nsrfvvslayayetkdalclvltlmnggdlkfhiyhmgqagfpearavfyaaeiccgled
    lhrerivyrdlkpenillddhghirisdlglavhvpegqtikgrvgtvgymapevvkner
    ytfspdwwalgcllyemiagqspfqkkikreeverlvkevpeeyserfspqarslcsqll
    ckdpaerlgcrggsarevkehplfkklnfkrlgagmleppfkpdpqaiyckdvldieqfs
    tvkgveleptdqdfyqkfatgsvpipwqnemvetecfqelnvfgldgsvppdldwkgqpp
    appkkgllqrlfs
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nyoB (B:)
    elenivantvllkareggggnrkgkskkwrqmlqfphisqceelrlslerdyhslcerqp
    igrllfrefcatrpelsrcvafldgvaeyevtpddkrkacgrqltqnflshtgpdlipev
    prqlvtnctqrleqgpckdlfqeltrltheylsvapfadyldsiyfnrflqwkwlerqpv
    tkntfrqyrvlgkggfgevcacqvratgkmyackklekkrikkrkgeamalnekqilekv
    nsrfvvslayayetkdalclvltlmnggdlkfhiyhmgqagfpearavfyaaeiccgled
    lhrerivyrdlkpenillddhghirisdlglavhvpegqtikgrvgtvgymapevvkner
    ytfspdwwalgcllyemiagqspfqqrkkkikreeverlvkevpeeyserfspqarslcs
    qllckdpaerlgcrggsarevkehplfkklnfkrlgagmleppfkpdpqaiyckdvldie
    qfstvkgveleptdqdfyqkfatgsvpipwqnemvetecfqelnvfgldgsvppdldwkg
    qppappkkgllqrlfsrqdccgncsdseeelptrl
    

    Sequence, based on observed residues (ATOM records):
    >3nyoB (B:)
    elenivantvllkareggggnrkgkskkwrqmlqfphisqceelrlslerdyhslcerqp
    igrllfrefcatrpelsrcvafldgvaeyevtpddkrkacgrqltqnflshtgpdlipev
    prqlvtnctqrleqgpckdlfqeltrltheylsvapfadyldsiyfnrflqwkwlerqpv
    tkntfrqyrvlgkggfgevcacqvratgkmyackklekkrikkrkgeamalnekqilekv
    nsrfvvslayayetkdalclvltlmnggdlkfhiyhmgqagfpearavfyaaeiccgled
    lhrerivyrdlkpenillddhghirisdlglavhvpegqtikgrvgtvgymapevvkner
    ytfspdwwalgcllyemiagqspfqkkikreeverlvkevpeeyserfspqarslcsqll
    ckdpaerlgcrggsarevkehplfkklnfkrlgagmleppfkpdpqaiyckdvldieqfs
    tvkgveleptdqdfyqkfatgsvpipwqnemvetecfqelnvfgldgsvppdldwkgqpp
    appkkgllqrlfs