PDB entry 3nym

View 3nym on RCSB PDB site
Description: The crystal structure of functionally unknown protein from Neisseria meningitidis MC58
Deposited on 2010-07-15, released 2010-09-22
The last revision was dated 2010-09-22, with a file datestamp of 2010-09-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.174
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein
    Species: Neisseria meningitidis serogroup B [TaxId:491]
    Gene: NMB0500, NMB1774
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JS17 (3-End)
      • expression tag (2)
  • Chain 'B':
    Compound: Uncharacterized protein
    Species: Neisseria meningitidis serogroup B [TaxId:491]
    Gene: NMB0500, NMB1774
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PEG, SO4, ACT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nymA (A:)
    snametlndikkilinvglyqgfdltdpkvseevnhetanmkwikdytsdgnwdnefked
    lknfldymevcqlalndknfkiasnslfmamiyagnlslifdsiktdistllsaeykkns
    fswpslde
    

    Sequence, based on observed residues (ATOM records):
    >3nymA (A:)
    ametlndikkilinvglyqgfdltdpkvseevnhetanmkwikdytsdgnwdnefkedlk
    nfldymevcqlalndknfkiasnslfmamiyagnlslifdsiktdistllsaeykknsfs
    wpsl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nymB (B:)
    snametlndikkilinvglyqgfdltdpkvseevnhetanmkwikdytsdgnwdnefked
    lknfldymevcqlalndknfkiasnslfmamiyagnlslifdsiktdistllsaeykkns
    fswpslde
    

    Sequence, based on observed residues (ATOM records):
    >3nymB (B:)
    etlndikkilinvglyqgfdltdpkvseevnhetanmkwikdytsdgnwdnefkedlknf
    ldymevcqlalndknfkiasnslfmamiyagnlslifdsiktdistllsaeykknsfswp
    sld