PDB entry 3nyl

View 3nyl on RCSB PDB site
Description: The X-ray structure of an antiparallel dimer of the human amyloid precursor protein E2 domain
Class: cell adhesion
Keywords: Alzheimer's disease, helical hairpin, CELL ADHESION
Deposited on 2010-07-15, released 2011-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.265
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Amyloid beta (A4) protein (Peptidase nexin-II, Alzheimer disease), isoform CRA_b
    Species: Homo sapiens [TaxId:9606]
    Gene: APP, hCG_1810805
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nyla_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nylA (A:)
    gshmpttaastpdavdkyletpgdenehahfqkakerleakhrermsqvmreweeaerqa
    knlpkadkkaviqhfqekvesleqeaanerqqlvethmarveamlndrrrlalenyital
    qavpprprhvfnmlkkyvraeqkdrqhtlkhfehvrmvdpkkaaqirsqvmthlrviyer
    mnqslsllynvpavaeeiqdevdellqkeq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nylA (A:)
    tpdavdkyletpgdenehahfqkakerleakhrermsqvmreweeaerqaknlpkadkka
    viqhfqekvesleqeaanerqqlvethmarveamlndrrrlalenyitalqavpprprhv
    fnmlkkyvraeqkdrqhtlkhfehvrmvdpkkaaqirsqvmthlrviyermnqslsllyn
    vpavaeeiqdevdell