SCOPe 2.05: Structural Classification of Proteins

PDB entry 3nyk

View 3nyk on RCSB PDB site
Description: The structure of cobalt-substituted pseudoazurin from Alcaligenes faecalis
Class: metal binding protein
Keywords: beta-sandwich, red-ox protein, divalent metal-ion, metalloprotein, METAL BINDING PROTEIN
Deposited on 2010-07-15, released 2010-10-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.151
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: pseudoazurin
Species: Alcaligenes faecalis [TaxId:511]
Database cross-references and differences (RAF-indexed):
- Uniprot P04377 (0-End)
Domains in SCOPe 2.05: d3nyka_
Heterogens: CO, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3nykA (A:)
enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia
sak

Sequence, based on observed residues (ATOM records): (download)

>3nykA (A:)
enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia