PDB entry 3nyi

View 3nyi on RCSB PDB site
Description: The crystal structure of a fat acid (stearic acid)-binding protein from Eubacterium ventriosum ATCC 27560.
Class: lipid binding protein
Keywords: stearic acid, DegV family protein, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, LIPID BINDING PROTEIN
Deposited on 2010-07-15, released 2010-09-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-21, with a file datestamp of 2016-12-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fat acid-binding protein
    Species: Eubacterium ventriosum [TaxId:411463]
    Gene: EUBVEN_01190
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nyia_
  • Chain 'B':
    Compound: fat acid-binding protein
    Species: Eubacterium ventriosum [TaxId:411463]
    Gene: EUBVEN_01190
    Database cross-references and differences (RAF-indexed):
    • Uniprot A5Z657 (3-295)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d3nyib1, d3nyib2
  • Heterogens: STE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nyiA (A:)
    snamykivsdsacdlskeylekhdvtivplsvsfdgetyyrdgvditrdecyqrmvddpk
    lfpktslpsvesyadvfrsfveqgfpvvcftittlfsgsynsainakslvledypdanic
    vidskqntvtqallidqfvrmledglsfeqamskldalmasarifftvgsldylkmggri
    gkvataatgklgvkpviimkdgdiglggigrnrnklknsvlqvakkyldennkdnfivsv
    gygydkeegfefmkevestldvkldsetnvaigivsavhtgpypiglgvirkyetl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nyiA (A:)
    mykivsdsacdlskeylekhdvtivplsvsfdgetyyrdgvditrdecyqrmvddpklfp
    ktslpsvesyadvfrsfveqgfpvvcftittlfsgsynsainakslvledypdanicvid
    skqntvtqallidqfvrmledglsfeqamskldalmasarifftvgsldylkmggrigkv
    ataatgklgvkpviimkdgdiglggigrnrnklknsvlqvakkyldennkdnfivsvgyg
    ydkeegfefmkevestldvkldsetnvaigivsavhtgpypiglgvirkyetl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nyiB (B:)
    snamykivsdsacdlskeylekhdvtivplsvsfdgetyyrdgvditrdecyqrmvddpk
    lfpktslpsvesyadvfrsfveqgfpvvcftittlfsgsynsainakslvledypdanic
    vidskqntvtqallidqfvrmledglsfeqamskldalmasarifftvgsldylkmggri
    gkvataatgklgvkpviimkdgdiglggigrnrnklknsvlqvakkyldennkdnfivsv
    gygydkeegfefmkevestldvkldsetnvaigivsavhtgpypiglgvirkyetl
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nyiB (B:)
    namykivsdsacdlskeylekhdvtivplsvsfdgetyyrdgvditrdecyqrmvddpkl
    fpktslpsvesyadvfrsfveqgfpvvcftittlfsgsynsainakslvledypdanicv
    idskqntvtqallidqfvrmledglsfeqamskldalmasarifftvgsldylkmggrig
    kvataatgklgvkpviimkdgdiglggigrnrnklknsvlqvakkyldennkdnfivsvg
    ygydkeegfefmkevestldvkldsetnvaigivsavhtgpypiglgvirkyetl