PDB entry 3nyh

View 3nyh on RCSB PDB site
Description: Crystal structure of lactoperoxidase complexed simultaneously with thiocyanate ion, iodide ion, bromide ion, chloride ion through the substrate diffusion channel reveals a preferential queue of the inorganic substrates towards the distal heme cavity
Deposited on 2010-07-15, released 2010-10-20
The last revision was dated 2010-10-20, with a file datestamp of 2010-10-15.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.191
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lactoperoxidase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HEM, CA, NAG, IOD, BR, CL, GOL, PEG, MPD, EDO, ZN, SCN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3nyhA (A:)
    swevgcgapvplvkcdenspyrtitgdcnnrrspalgaanralarwlpaeyedglalpfg
    wtqrktrngfrvplarevsnkivgyldeegvldqnrsllfmqwgqivdhdldfapetelg
    snehsktqceeyciqgdncfpimfpkndpklktqgkcmpffragfvcptppyqslareqi
    navtsfldaslvygsepslasrlrnlssplglmavnqeawdhglaylpfnnkkpspcefi
    nttarvpcflagdfraseqillatahtlllrehnrlarelkklnphwngeklyqearkil
    gafiqiitfrdylpivlgsemqkwippyqgynnsvdprisnvftfafrfghmevpstvsr
    ldenyqpwgpeaelplhtlffntwriikdggidplvrgllakksklmnqdkmvtselrnk
    lfqpthkihgfdlaainlqrcrdhgmpgynswrgfcglsqpktlkglqtvlknkilakkl
    mdlyktpdnidiwiggnaepmvergrvgpllacllgrqfqqirdgdrfwwenpgvftekq
    rdslqkvsfsrlicdnthitkvplhafqannyphdfvdcstvdkldlspwasren