PDB entry 3nye

View 3nye on RCSB PDB site
Description: Crystal Structure of Pseudomonas aeruginosa D-Arginine Dehydrogenase in Complex with Imino-Arginine
Deposited on 2010-07-14, released 2010-09-15
The last revision was dated 2011-01-05, with a file datestamp of 2010-12-31.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.145
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-Arginine Dehydrogenase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA3863
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HXE3 (7-380)
      • expression tag (0-6)
  • Heterogens: FAD, IAR, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3nyeA (A:)
    hhhhhhpieadylvigagiagastgywlsahgrvvvlereaqpgyhstgrsaahytvayg
    tpqvraltaasraffdnppagfcehpllsprpemvvdfsddpeelrrqyesgkalvpqmr
    lldaeqacsivpvlrrdkvfgatydptgadidtdalhqgylrgirrnqgqvlcnhealei
    rrvdgawevrcdagsyraavlvnaagawcdaiaglagvrplglqpkrrsafifapppgid
    chdwpmlvsldesfylkpdagmllgspanadpveahdvqpeqldiatgmylieeattlti
    rrpehtwaglrsfvadgdlvagyaanaegffwvaaqggygiqtsaamgeasaalirhqpl
    pahlrehgldeamlsprrlsp