PDB entry 3nyb

View 3nyb on RCSB PDB site
Description: Structure and function of the polymerase core of TRAMP, a RNA surveillance complex
Deposited on 2010-07-14, released 2010-08-04
The last revision was dated 2010-09-08, with a file datestamp of 2010-09-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.194
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(A) RNA polymerase protein 2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PAP2, TRF4, YOL115W, O0716, HRC584
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53632 (2-322)
      • expression tag (0-1)
      • engineered mutation (134)
  • Chain 'B':
    Compound: Protein AIR2
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: AIR2, YDL175C
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3nybA (A:)
    gsypwilnhdhskqkeisdwltfeikdfvayispsreeieirnqtistireavkqlwpda
    dlhvfgsystdlylpgsdidcvvtselggkesrnnlyslashlkkknlatevevvakarv
    piikfvephsgihiavsfertngieaaklirewlddtpglrelvlivkqflharrlnnvh
    tgglggfsiiclvfsflhmhpriitneidpkdnlgvllieffelygknfgyddvalgssd
    gypvyfpkstwsaiqpiknpfslaiqdpgdesnnisrgsfnirdikkafagafdlltnrc
    felhsatfkdrlgksilgnviky
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nybB (B:)
    gswkkvqctlckskkhskercpsiwrayilvddnekakpkvlpfhtiycyncggkghfgd
    dckekrssrvpnedgsaftgsnl
    

    Sequence, based on observed residues (ATOM records):
    >3nybB (B:)
    qctlckskkhskercpsiwrayilvhtiycyncggkghfgddckekrssrvpnedgsaft
    gsnl