PDB entry 3ny8

View 3ny8 on RCSB PDB site
Description: crystal structure of the human beta2 adrenergic receptor in complex with the inverse agonist ici 118,551
Deposited on 2010-07-14, released 2010-08-11
The last revision was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 2.84 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-2 adrenergic receptor, Lysozyme
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: ADRB2, ADRB2R, B2AR, E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07550 (Start-237)
      • engineered mutation (129)
      • engineered mutation (194)
    • Uniprot P00720 (238-397)
      • engineered mutation (290)
      • engineered mutation (333)
    • Uniprot P07550 (398-End)
  • Heterogens: CLR, JRZ, OLA, OLC, PGE, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ny8A (A:)
    dykddddamgqpgngsafllapnrshapdhdvtqqrdevwvvgmgivmslivlaivfgnv
    lvitaiakferlqtvtnyfitslacadlvmglavvpfgaahilmkmwtfgnfwcefwtsi
    dvlcvtasiwtlcviavdryfaitspfkyqslltknkarviilmvwivsgltsflpiqmh
    wyrathqeaincyaeetccdfftnqayaiassivsfyvplvimvfvysrvfqeakrqlni
    femlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitkdea
    eklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrmlqq
    krwdeaavnlaksrwynqtpnrakrvittfrtgtwdaykfclkehkalktlgiimgtftl
    cwlpffivnivhviqdnlirkevyillnwigyvnsgfnpliycrspdfriafqellclrr
    sslkhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3ny8A (A:)
    wvvgmgivmslivlaivfgnvlvitaiakferlqtvtnyfitslacadlvmglavvpfga
    ahilmkmwtfgnfwcefwtsidvlcvtasiwtlcviavdryfaitspfkyqslltknkar
    viilmvwivsgltsflpiqmhwyrathqeaincyaeetccdfftnqayaiassivsfyvp
    lvimvfvysrvfqeakrqlnifemlrideglrlkiykdtegyytigighlltkspslnaa
    kseldkaigrntngvitkdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinm
    vfqmgetgvagftnslrmlqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk
    fclkehkalktlgiimgtftlcwlpffivnivhviqdnlirkevyillnwigyvnsgfnp
    liycrspdfriafqellcl