PDB entry 3ny5

View 3ny5 on RCSB PDB site
Description: Crystal structure of the RBD domain of serine/threonine-protein kinase B-raf from Homo sapiens. Northeast Structural Genomics Consortium Target HR4694F
Class: transferase
Keywords: NESG, Structural Genomics, PSI-Biology, Protein Structure Initiative, Northeast Structural Genomics Consortium, TRANSFERASE
Deposited on 2010-07-14, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.99 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase B-raf
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, RAFB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15056 (11-End)
      • expression tag (9-10)
    Domains in SCOPe 2.07: d3ny5a1, d3ny5a2
  • Chain 'B':
    Compound: Serine/threonine-protein kinase B-raf
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, RAFB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15056 (11-End)
      • expression tag (8-10)
    Domains in SCOPe 2.07: d3ny5b1, d3ny5b2
  • Chain 'C':
    Compound: Serine/threonine-protein kinase B-raf
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, RAFB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15056 (11-End)
      • expression tag (10)
    Domains in SCOPe 2.07: d3ny5c1, d3ny5c2
  • Chain 'D':
    Compound: Serine/threonine-protein kinase B-raf
    Species: Homo sapiens [TaxId:9606]
    Gene: BRAF, BRAF1, RAFB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15056 (11-End)
      • expression tag (9-10)
    Domains in SCOPe 2.07: d3ny5d1, d3ny5d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ny5A (A:)
    mghhhhhhshmqkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyriq
    dgekkpigwdtdiswltgeelhvevlenvpltthnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ny5A (A:)
    hmqkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyriqkkpigwdtd
    iswltgeelhvevlenvplt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3ny5B (B:)
    mghhhhhhshmqkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyriq
    dgekkpigwdtdiswltgeelhvevlenvpltthnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ny5B (B:)
    shmqkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyriqekkpigwd
    tdiswltgeelhvevlenvpltth
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3ny5C (C:)
    mghhhhhhshmqkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyriq
    dgekkpigwdtdiswltgeelhvevlenvpltthnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ny5C (C:)
    mqkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyriqkkpigwdtdi
    swltgeelhvevlenvpltth
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3ny5D (D:)
    mghhhhhhshmqkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyriq
    dgekkpigwdtdiswltgeelhvevlenvpltthnf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ny5D (D:)
    hmqkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyrikkpigwdtdi
    swltgeelhvevlenvpl