PDB entry 3ny3

View 3ny3 on RCSB PDB site
Description: Structure of the ubr-box of UBR2 in complex with N-degron
Deposited on 2010-07-14, released 2010-08-11
The last revision was dated 2010-10-20, with a file datestamp of 2010-10-15.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.191
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase UBR2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBR2, C6orf133, KIAA0349
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: N-degron
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3NY3 (0-3)
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ny3A (A:)
    gplgslcgrvfkvgeptyscrdcavdptcvlcmecflgsihrdhryrmttsggggfcdcg
    dteawkegpycqkhe
    

    Sequence, based on observed residues (ATOM records):
    >3ny3A (A:)
    lcgrvfkvgeptyscrdcavdptcvlcmecflgsihrdhryrmttsggggfcdcgdteaw
    kegpycqkhe
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3ny3B (B:)
    rifs