PDB entry 3ny2

View 3ny2 on RCSB PDB site
Description: Structure of the ubr-box of UBR2 ubiquitin ligase
Deposited on 2010-07-14, released 2010-08-11
The last revision was dated 2010-10-20, with a file datestamp of 2010-10-15.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.233
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase UBR2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBR2, C6orf133, KIAA0349
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IWV8 (5-74)
      • expression tag (3-4)
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase UBR2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBR2, C6orf133, KIAA0349
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IWV8 (5-74)
      • expression tag (3-4)
  • Chain 'C':
    Compound: E3 ubiquitin-protein ligase UBR2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBR2, C6orf133, KIAA0349
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IWV8 (5-74)
      • expression tag (4)
  • Chain 'D':
    Compound: E3 ubiquitin-protein ligase UBR2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBR2, C6orf133, KIAA0349
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IWV8 (5-74)
      • expression tag (2-4)
  • Chain 'E':
    Compound: E3 ubiquitin-protein ligase UBR2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBR2, C6orf133, KIAA0349
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: E3 ubiquitin-protein ligase UBR2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBR2, C6orf133, KIAA0349
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IWV8 (5-74)
      • expression tag (3-4)
  • Chain 'G':
    Compound: E3 ubiquitin-protein ligase UBR2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBR2, C6orf133, KIAA0349
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IWV8 (5-74)
      • expression tag (2-4)
  • Chain 'H':
    Compound: E3 ubiquitin-protein ligase UBR2
    Species: Homo sapiens [TaxId:9606]
    Gene: UBR2, C6orf133, KIAA0349
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IWV8 (5-74)
      • expression tag (3-4)
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ny2A (A:)
    gplgslcgrvfkvgeptyscrdcavdptcvlcmecflgsihrdhryrmttsggggfcdcg
    dteawkegpycqkhe
    

    Sequence, based on observed residues (ATOM records):
    >3ny2A (A:)
    gslcgrvfkvgeptyscrdcavdptcvlcmecflgsihrdhryrmttsggggfcdcgdte
    awkegpycqkhe
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3ny2B (B:)
    gplgslcgrvfkvgeptyscrdcavdptcvlcmecflgsihrdhryrmttsggggfcdcg
    dteawkegpycqkhe
    

    Sequence, based on observed residues (ATOM records):
    >3ny2B (B:)
    gslcgrvfkvgeptyscrdcavdptcvlcmecflgsihrdhryrmttsggggfcdcgdte
    awkegpycqkhe
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3ny2C (C:)
    gplgslcgrvfkvgeptyscrdcavdptcvlcmecflgsihrdhryrmttsggggfcdcg
    dteawkegpycqkhe
    

    Sequence, based on observed residues (ATOM records):
    >3ny2C (C:)
    slcgrvfkvgeptyscrdcavdptcvlcmecflgsihrdhryrmttsggggfcdcgdtea
    wkegpycqkhe
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3ny2D (D:)
    gplgslcgrvfkvgeptyscrdcavdptcvlcmecflgsihrdhryrmttsggggfcdcg
    dteawkegpycqkhe
    

    Sequence, based on observed residues (ATOM records):
    >3ny2D (D:)
    lgslcgrvfkvgeptyscrdcavdptcvlcmecflgsihrdhryrmttsggggfcdcgdt
    eawkegpycqkhe
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3ny2E (E:)
    gplgslcgrvfkvgeptyscrdcavdptcvlcmecflgsihrdhryrmttsggggfcdcg
    dteawkegpycqkhe
    

    Sequence, based on observed residues (ATOM records):
    >3ny2E (E:)
    lcgrvfkvgeptyscrdcavdptcvlcmecflgsihrdhryrmttsggggfcdcgdteaw
    kegpycqkhe
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3ny2F (F:)
    gplgslcgrvfkvgeptyscrdcavdptcvlcmecflgsihrdhryrmttsggggfcdcg
    dteawkegpycqkhe
    

    Sequence, based on observed residues (ATOM records):
    >3ny2F (F:)
    gslcgrvfkvgeptyscrdcavdptcvlcmecflgsihrdhryrmttsggggfcdcgdte
    awkegpycqkhe
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3ny2G (G:)
    gplgslcgrvfkvgeptyscrdcavdptcvlcmecflgsihrdhryrmttsggggfcdcg
    dteawkegpycqkhe
    

    Sequence, based on observed residues (ATOM records):
    >3ny2G (G:)
    lgslcgrvfkvgeptyscrdcavdptcvlcmecflgsihrdhryrmttsggggfcdcgdt
    eawkegpycqkhe
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3ny2H (H:)
    gplgslcgrvfkvgeptyscrdcavdptcvlcmecflgsihrdhryrmttsggggfcdcg
    dteawkegpycqkhe
    

    Sequence, based on observed residues (ATOM records):
    >3ny2H (H:)
    gslcgrvfkvgeptyscrdcavdptcvlcmecflgsihrdhryrmttsggggfcdcgdte
    awkegpycqkhe