PDB entry 3ny1

View 3ny1 on RCSB PDB site
Description: Structure of the ubr-box of the UBR1 ubiquitin ligase
Deposited on 2010-07-14, released 2010-08-11
The last revision was dated 2010-10-20, with a file datestamp of 2010-10-15.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.197
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase UBR1
    Species: Homo sapiens [TaxId:9606]
    Gene: UBR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IWV7 (5-End)
      • expression tag (3-4)
  • Chain 'B':
    Compound: E3 ubiquitin-protein ligase UBR1
    Species: Homo sapiens [TaxId:9606]
    Gene: UBR1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ny1A (A:)
    gplgsqlcgrvfksgettyscrdcaidptcvlcmdcfqdsvhknhrykmhtstgggfcdc
    gdteawktgpfcvnhep
    

    Sequence, based on observed residues (ATOM records):
    >3ny1A (A:)
    gsqlcgrvfksgettyscrdcaidptcvlcmdcfqdsvhknhrykmhtstgggfcdcgdt
    eawktgpfcvnhe
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3ny1B (B:)
    gplgsqlcgrvfksgettyscrdcaidptcvlcmdcfqdsvhknhrykmhtstgggfcdc
    gdteawktgpfcvnhep
    

    Sequence, based on observed residues (ATOM records):
    >3ny1B (B:)
    lcgrvfksgettyscrdcaidptcvlcmdcfqdsvhknhrykmhtstgggfcdcgdteaw
    ktgpfcvnhe