PDB entry 3nxz

View 3nxz on RCSB PDB site
Description: crystal structure of uree from helicobacter pylori (cu2+ bound form)
Deposited on 2010-07-14, released 2010-08-25
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: urease accessory protein uree
    Species: Helicobacter pylori [TaxId:210]
    Gene: HP_0070, ureE
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: urease accessory protein uree
    Species: Helicobacter pylori [TaxId:210]
    Gene: HP_0070, ureE
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: urease accessory protein uree
    Species: Helicobacter pylori [TaxId:210]
    Gene: HP_0070, ureE
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: urease accessory protein uree
    Species: Helicobacter pylori [TaxId:210]
    Gene: HP_0070, ureE
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CU, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nxzA (A:)
    miierlvgnlrdlnpldfsvdhvdlewfetrkkiarfktrqgkdiairlkdapklglsqg
    dilfkeekeiiavnildsevihiqaksvaevakicyeignrhaalyygesqfefktpfek
    ptlalleklgvqnrvlsskldskerltvsmphsepnfkvslasdfkvvvk
    

    Sequence, based on observed residues (ATOM records):
    >3nxzA (A:)
    miierlvgnlrdlnpldfsvdhvdlewfetrkkiarfktrqgkdiairlkdapklglsqg
    dilfkeekeiiavnildsevihiqaksvaevakicyeignrhaalyygesqfefktpfek
    ptlalleklgvqnrvlsskldskerltvs
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nxzB (B:)
    miierlvgnlrdlnpldfsvdhvdlewfetrkkiarfktrqgkdiairlkdapklglsqg
    dilfkeekeiiavnildsevihiqaksvaevakicyeignrhaalyygesqfefktpfek
    ptlalleklgvqnrvlsskldskerltvsmphsepnfkvslasdfkvvvk
    

    Sequence, based on observed residues (ATOM records):
    >3nxzB (B:)
    iierlvgnlrdlnpldfsvdhvdlewfetrkkiarfktrqgkdiairlkdapklglsqgd
    ilfkeekeiiavnildsevihiqaksvaevakicyeignrhaalyygesqfefktpfekp
    tlalleklgvqnrvlsskldskerltv
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nxzC (C:)
    miierlvgnlrdlnpldfsvdhvdlewfetrkkiarfktrqgkdiairlkdapklglsqg
    dilfkeekeiiavnildsevihiqaksvaevakicyeignrhaalyygesqfefktpfek
    ptlalleklgvqnrvlsskldskerltvsmphsepnfkvslasdfkvvvk
    

    Sequence, based on observed residues (ATOM records):
    >3nxzC (C:)
    iierlvgnlrdlnpldfsvdhvdlewfetrkkiarfktrqgkdiairlkdapklglsqgd
    ilfkeekeiiavnildsevihiqaksvaevakicyeignrhaalyygesqfefktpfekp
    tlalleklgvqnrvlsskldskerltvs
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nxzD (D:)
    miierlvgnlrdlnpldfsvdhvdlewfetrkkiarfktrqgkdiairlkdapklglsqg
    dilfkeekeiiavnildsevihiqaksvaevakicyeignrhaalyygesqfefktpfek
    ptlalleklgvqnrvlsskldskerltvsmphsepnfkvslasdfkvvvk
    

    Sequence, based on observed residues (ATOM records):
    >3nxzD (D:)
    iierlvgnlrdlnpldfsvdhvdlewfetrkkiarfktrqgkdiairlkdapklglsqgd
    ilfkeekeiiavnildsevihiqaksvaevakicyeignrhaalyygesqfefktpfekp
    tlalleklgvqnrvlsskldskerltvsm