PDB entry 3nxs

View 3nxs on RCSB PDB site
Description: Crystal structure of LAO/AO transport system from Mycobacterium smegmatis bound to GDP
Class: transport protein
Keywords: Seattle Structural Genomics Center for Infectious Disease, SSGCID, Mycobacterium, pathogenic bacterium, tuberculosis, methylmalonic aciduria, ortholog, RAS-like GTPase superfamily, G-domain, arginine, ornithine, transport system, GTPAse, mislabeled as an ATPase, metallochaperone, TRANSPORT PROTEIN
Deposited on 2010-07-14, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-03, with a file datestamp of 2015-05-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: LAO/AO transport system ATPase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: MSMEG_3160
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nxsa_
  • Heterogens: GDP, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nxsA (A:)
    gpgsmkavnvhelaqsirdgdrsalaraitlvestradhreqaqqllldlmpeagsamhv
    gitgvpgvgksttiealgmhlieaghrvavlavdpsstrtggsilgdktrmarlavhpda
    yirpsptsgtlggvakatretivlleaagydvilvetvgvgqsevtvagmvdtfvfltla
    rtgdqlqgikkgvleladvivvnkadgehaveakaaarelsgairliypreslwrppvlt
    msavegtglpelwetvlrhrevleeagefearrrtqqvewtwsmvrdavldrvmnhpevr
    rirddveqrvrlgeltpalaaqeildaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nxsA (A:)
    nvhelaqsirdgdrsalaraitlvestradhreqaqqllldlmpeagsamhvgitgvpgv
    gksttiealgmhlieaghrvavlavdrmarlavhpdayirpsptsgtlggvakatretiv
    lleaagydvilvetvgvgqsevtvagmvdtfvfltlartgdqlqgikkgvleladvivvn
    kadgehaveakaaarelsgairliypreslwrppvltmsavegtglpelwetvlrhrevl
    eeagefearrrtqqvewtwsmvrdavldrvmnhpevrrirddveqrvrlgeltpalaaqe
    ildaaq