PDB entry 3nxp

View 3nxp on RCSB PDB site
Description: Crystal structure of human prethrombin-1
Deposited on 2010-07-14, released 2010-11-10
The last revision was dated 2011-01-19, with a file datestamp of 2011-01-14.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.199
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prethrombin-1
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (Start-423)
      • engineered mutation (128)
  • Heterogens: NAG, TRS, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nxpA (A:)
    segssvnlsppleqcvpdrgqqyqgrlavtthglpclawasaqakalskhqdfnsavqlv
    enfcrnpdgdeegvwcyvagkpgdfgycdlnyceeaveeetgdgldedsdraiegatats
    eyqtffnpatfgsgeadcglrplfekksledkterellesyidgrivegsdaeigmspwq
    vmlfrkspqellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerni
    ekismlekiyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagyk
    grvtgwgnlketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdeg
    krgdacegdsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvid
    qfge
    

    Sequence, based on observed residues (ATOM records):
    >3nxpA (A:)
    qcvpdrgqqyqgrlavtthglpclawasaqakalskhqdfnsavqlvenfcrnpdgdeeg
    vwcyvagkpgdfgycdlnyceeaveetseyqtffnpatfgsgeadcglrplfekksledk
    terellesyidgrivegsdaeigmspwqvmlfrkspqellcgaslisdrwvltaahclly
    ppwdknftendllvrigkhsrtryerniekismlekiyihprynwrenldrdialmklkk
    pvafsdyihpvclpdretaasllqagykgrvtgwgnlketwtanqpsvlqvvnlpiverp
    vckdstriritdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegc
    drdgkygfythvfrlkkwiqkvidqfge