PDB entry 3nxn

View 3nxn on RCSB PDB site
Description: X-ray structure of ester chemical analogue 'covalent dimer' [Ile50,O-Ile50']HIV-1 protease complexed with KVS-1 inhibitor
Deposited on 2010-07-14, released 2011-11-02
The last revision was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.195
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protease covalent dimer
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3NXN (0-202)
  • Heterogens: KVS, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3nxnA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvieelnlpgcwkpkliggiggfikvrqyd
    qipveiaghkaigtvlvgptpvniigrnlltqigatlnfcggggpqitlwkrplvtirig
    gqlkealldtgaddtvieelnlpgcwkpkliggxggfikvrqydqipveiaghkaigtvl
    vgptpvniigrnlltqigatlnf