PDB entry 3nxk

View 3nxk on RCSB PDB site
Description: Crystal Structure of Probable Cytoplasmic L-asparaginase from Campylobacter jejuni
Deposited on 2010-07-14, released 2010-08-04
The last revision was dated 2010-08-04, with a file datestamp of 2010-07-30.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.169
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytoplasmic L-asparaginase
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: ansA, Cj0029
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Cytoplasmic L-asparaginase
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: ansA, Cj0029
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Cytoplasmic L-asparaginase
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: ansA, Cj0029
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Cytoplasmic L-asparaginase
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: ansA, Cj0029
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Cytoplasmic L-asparaginase
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: ansA, Cj0029
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Cytoplasmic L-asparaginase
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: ansA, Cj0029
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: Cytoplasmic L-asparaginase
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: ansA, Cj0029
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Cytoplasmic L-asparaginase
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: ansA, Cj0029
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, ACY, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nxkA (A:)
    snamkkaksriailgtggtiagfidstiattgyaagaididvlikavpqirdladisweq
    ianidssnmcdeiwlrlakkiaklfaegidgvvithgtdtmeetayflnltiksdkpvvl
    vgamrpstaisadgpknlynavalvvnkeaknkgvmvaindkilsargvvkthslnvdaf
    sspdfgdlgyivdgkvffynnvikahtknapfdvskltslpkvdilysysndgsgvaaka
    lfehgtkgivvagsgagsihknqkdvlkellkkglkvvvssrvvagcvavsdsdeklgfi
    saedlnpqkarvllmlaltktsdpkkiqeyflky
    

    Sequence, based on observed residues (ATOM records):
    >3nxkA (A:)
    ksriailgtggtiagfidstiattgyaagaididvlikavpqirdladisweqianidss
    nmcdeiwlrlakkiaklfaegidgvvithgtdtmeetayflnltiksdkpvvlvgamrps
    taisadgpknlynavalvvnkeaknkgvmvaindkilsargvvkthslnvdafsspdfgd
    lgyivdgkvffynnvikahtknapfdvskltslpkvdilysysndgsgvaakalfehgtk
    givvagsgagsihknqkdvlkellkkglkvvvssrvvagcvavsdsdeklgfisaedlnp
    qkarvllmlaltktsdpkkiqeyflky
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nxkB (B:)
    snamkkaksriailgtggtiagfidstiattgyaagaididvlikavpqirdladisweq
    ianidssnmcdeiwlrlakkiaklfaegidgvvithgtdtmeetayflnltiksdkpvvl
    vgamrpstaisadgpknlynavalvvnkeaknkgvmvaindkilsargvvkthslnvdaf
    sspdfgdlgyivdgkvffynnvikahtknapfdvskltslpkvdilysysndgsgvaaka
    lfehgtkgivvagsgagsihknqkdvlkellkkglkvvvssrvvagcvavsdsdeklgfi
    saedlnpqkarvllmlaltktsdpkkiqeyflky
    

    Sequence, based on observed residues (ATOM records):
    >3nxkB (B:)
    ksriailgtggtiagfidstiattgyaagaididvlikavpqirdladisweqianidss
    nmcdeiwlrlakkiaklfaegidgvvithgtdtmeetayflnltiksdkpvvlvgamrps
    taisadgpknlynavalvvnkeaknkgvmvaindkilsargvvkthslnvdafsspdfgd
    lgyivdgkvffynnvikahtknapfdvskltslpkvdilysysndgsgvaakalfehgtk
    givvagsgagsihknqkdvlkellkkglkvvvssrvvagcvavsdsdeklgfisaedlnp
    qkarvllmlaltktsdpkkiqeyflky
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nxkC (C:)
    snamkkaksriailgtggtiagfidstiattgyaagaididvlikavpqirdladisweq
    ianidssnmcdeiwlrlakkiaklfaegidgvvithgtdtmeetayflnltiksdkpvvl
    vgamrpstaisadgpknlynavalvvnkeaknkgvmvaindkilsargvvkthslnvdaf
    sspdfgdlgyivdgkvffynnvikahtknapfdvskltslpkvdilysysndgsgvaaka
    lfehgtkgivvagsgagsihknqkdvlkellkkglkvvvssrvvagcvavsdsdeklgfi
    saedlnpqkarvllmlaltktsdpkkiqeyflky
    

    Sequence, based on observed residues (ATOM records):
    >3nxkC (C:)
    ksriailgtggtiagfidstiattgyaagaididvlikavpqirdladisweqianidss
    nmcdeiwlrlakkiaklfaegidgvvithgtdtmeetayflnltiksdkpvvlvgamrps
    taisadgpknlynavalvvnkeaknkgvmvaindkilsargvvkthslnvdafsspdfgd
    lgyivdgkvffynnvikahtknapfdvskltslpkvdilysysndgsgvaakalfehgtk
    givvagsgagsihknqkdvlkellkkglkvvvssrvvagcvavsdsdeklgfisaedlnp
    qkarvllmlaltktsdpkkiqeyflky
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nxkD (D:)
    snamkkaksriailgtggtiagfidstiattgyaagaididvlikavpqirdladisweq
    ianidssnmcdeiwlrlakkiaklfaegidgvvithgtdtmeetayflnltiksdkpvvl
    vgamrpstaisadgpknlynavalvvnkeaknkgvmvaindkilsargvvkthslnvdaf
    sspdfgdlgyivdgkvffynnvikahtknapfdvskltslpkvdilysysndgsgvaaka
    lfehgtkgivvagsgagsihknqkdvlkellkkglkvvvssrvvagcvavsdsdeklgfi
    saedlnpqkarvllmlaltktsdpkkiqeyflky
    

    Sequence, based on observed residues (ATOM records):
    >3nxkD (D:)
    aksriailgtggtiagfidstiattggaididvlikavpqirdladisweqianidssnm
    cdeiwlrlakkiaklfaegidgvvithgtdtmeetayflnltiksdkpvvlvgamrpsta
    isadgpknlynavalvvnkeaknkgvmvaindkilsargvvkthslnvdafsspdfgdlg
    yivdgkvffynnvikahtknapfdvskltslpkvdilysysndgsgvaakalfehgtkgi
    vvagsgagsihknqkdvlkellkkglkvvvssrvvagcvavsdsdeklgfisaedlnpqk
    arvllmlaltktsdpkkiqeyflky
    

  • Chain 'E':
    Sequence, based on SEQRES records:
    >3nxkE (E:)
    snamkkaksriailgtggtiagfidstiattgyaagaididvlikavpqirdladisweq
    ianidssnmcdeiwlrlakkiaklfaegidgvvithgtdtmeetayflnltiksdkpvvl
    vgamrpstaisadgpknlynavalvvnkeaknkgvmvaindkilsargvvkthslnvdaf
    sspdfgdlgyivdgkvffynnvikahtknapfdvskltslpkvdilysysndgsgvaaka
    lfehgtkgivvagsgagsihknqkdvlkellkkglkvvvssrvvagcvavsdsdeklgfi
    saedlnpqkarvllmlaltktsdpkkiqeyflky
    

    Sequence, based on observed residues (ATOM records):
    >3nxkE (E:)
    ksriailgtggtiagfaididvlikavpqirdladisweqianidssnmcdeiwlrlakk
    iaklfaegidgvvithgtdtmeetayflnltiksdkpvvlvgamrpstaisadgpknlyn
    avalvvnkeaknkgvmvaindkilsargvvkthslnvdafsspdfgdlgyivdgkvffyn
    nvikahtknapfdvskltslpkvdilysysndgsgvaakalfehgtkgivvagsgagsih
    knqkdvlkellkkglkvvvssrvvagcvavsdsdeklgfisaedlnpqkarvllmlaltk
    tsdpkkiqeyflky
    

  • Chain 'F':
    Sequence, based on SEQRES records:
    >3nxkF (F:)
    snamkkaksriailgtggtiagfidstiattgyaagaididvlikavpqirdladisweq
    ianidssnmcdeiwlrlakkiaklfaegidgvvithgtdtmeetayflnltiksdkpvvl
    vgamrpstaisadgpknlynavalvvnkeaknkgvmvaindkilsargvvkthslnvdaf
    sspdfgdlgyivdgkvffynnvikahtknapfdvskltslpkvdilysysndgsgvaaka
    lfehgtkgivvagsgagsihknqkdvlkellkkglkvvvssrvvagcvavsdsdeklgfi
    saedlnpqkarvllmlaltktsdpkkiqeyflky
    

    Sequence, based on observed residues (ATOM records):
    >3nxkF (F:)
    aksriailgtggtiaikavpqirdladisweqianidssnmcdeiwlrlakkiaklfaeg
    idgvvithgtdtmeetayflnltiksdkpvvlvgamrpstaisadgpknlynavalvvnk
    eaknkgvmvaindkilsargvvkthslnvdafsspdfgdlgyivdgkvffynnvikahtk
    napfdvskltslpkvdilysysndgsgvaakalfehgtkgivvagsgagsihknqkdvlk
    ellkkglkvvvssrvvagcvavsdsdeklgfisaedlnpqkarvllmlaltktsdpkkiq
    eyflky
    

  • Chain 'G':
    Sequence, based on SEQRES records:
    >3nxkG (G:)
    snamkkaksriailgtggtiagfidstiattgyaagaididvlikavpqirdladisweq
    ianidssnmcdeiwlrlakkiaklfaegidgvvithgtdtmeetayflnltiksdkpvvl
    vgamrpstaisadgpknlynavalvvnkeaknkgvmvaindkilsargvvkthslnvdaf
    sspdfgdlgyivdgkvffynnvikahtknapfdvskltslpkvdilysysndgsgvaaka
    lfehgtkgivvagsgagsihknqkdvlkellkkglkvvvssrvvagcvavsdsdeklgfi
    saedlnpqkarvllmlaltktsdpkkiqeyflky
    

    Sequence, based on observed residues (ATOM records):
    >3nxkG (G:)
    ksriailgtggtiagfidstiattggaididvlikavpqirdladisweqianidssnmc
    deiwlrlakkiaklfaegidgvvithgtdtmeetayflnltiksdkpvvlvgamrpstai
    sadgpknlynavalvvnkeaknkgvmvaindkilsargvvkthslnvdafsspdfgdlgy
    ivdgkvffynnvikahtknapfdvskltslpkvdilysysndgsgvaakalfehgtkgiv
    vagsgagsihknqkdvlkellkkglkvvvssrvvagcvavsdsdeklgfisaedlnpqka
    rvllmlaltktsdpkkiqeyflky
    

  • Chain 'H':
    Sequence, based on SEQRES records:
    >3nxkH (H:)
    snamkkaksriailgtggtiagfidstiattgyaagaididvlikavpqirdladisweq
    ianidssnmcdeiwlrlakkiaklfaegidgvvithgtdtmeetayflnltiksdkpvvl
    vgamrpstaisadgpknlynavalvvnkeaknkgvmvaindkilsargvvkthslnvdaf
    sspdfgdlgyivdgkvffynnvikahtknapfdvskltslpkvdilysysndgsgvaaka
    lfehgtkgivvagsgagsihknqkdvlkellkkglkvvvssrvvagcvavsdsdeklgfi
    saedlnpqkarvllmlaltktsdpkkiqeyflky
    

    Sequence, based on observed residues (ATOM records):
    >3nxkH (H:)
    ksriailgtggtiagfidstiattgyaagaididvlikavpqirdladisweqianidss
    nmcdeiwlrlakkiaklfaegidgvvithgtdtmeetayflnltiksdkpvvlvgamrps
    taisadgpknlynavalvvnkeaknkgvmvaindkilsargvvkthslnvdafsspdfgd
    lgyivdgkvffynnvikahtknapfdvskltslpkvdilysysndgsgvaakalfehgtk
    givvagsgagsihknqkdvlkellkkglkvvvssrvvagcvavsdsdeklgfisaedlnp
    qkarvllmlaltktsdpkkiqeyflky