PDB entry 3nxh

View 3nxh on RCSB PDB site
Description: crystal structure of the transcriptional regulator yvhj from bacillus subtilis. northeast structural genomics consortium target sr735.
Deposited on 2010-07-13, released 2010-08-04
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulator yvhJ
    Species: Bacillus subtilis subsp. subtilis [TaxId:224308]
    Gene: BSU35520, yvhJ
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nxhA (A:)
    mkkkpfsilfmgiedyatkgqkgrsdslivvtldpknktmkmlsiprdtrvqlagdttgs
    ktkinaayskggkdetvetvenflqipidkyvtvdfdgfkdvinevggidvdvpfdfdek
    sdvdeskriyfkkgemhlngeealayarmrkqdkrgdfgrndrqkqilnalidrmssasn
    iakidkiaekasenvetniriteglalqqiysgftskkidtlsitgsdlylgpnntyyfe
    pdatnlekvrktlqehldytplehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nxhA (A:)
    mkkkpfsilfmgiedyatkgqkgrsdslivvtldpknktmkmlsiprdtrvqlasktkin
    aayskggkdetvetvenflqipidkyvtvdfdgfkdvinevggidvdvpemhlngeeala
    yadfgrndrqkqilnalidrmsdkiaekasenvetniriteglalqqiysgftskkidtl
    sitgsdlylgpnntyyfepdatnlekvrktlqehldyt