PDB entry 3nxg

View 3nxg on RCSB PDB site
Description: JC polyomavirus VP1
Class: viral protein
Keywords: beta-sandwich jelly roll, viral protein
Deposited on 2010-07-13, released 2010-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-17, with a file datestamp of 2010-11-12.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.175
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major capsid protein VP1
    Species: JC polyomavirus [TaxId:10632]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nxga_
  • Chain 'B':
    Compound: Major capsid protein VP1
    Species: JC polyomavirus [TaxId:10632]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nxgb_
  • Chain 'C':
    Compound: Major capsid protein VP1
    Species: JC polyomavirus [TaxId:10632]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nxgc_
  • Chain 'D':
    Compound: Major capsid protein VP1
    Species: JC polyomavirus [TaxId:10632]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nxgd_
  • Chain 'E':
    Compound: Major capsid protein VP1
    Species: JC polyomavirus [TaxId:10632]
    Gene: VP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nxge_
  • Heterogens: GOL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nxgA (A:)
    gshmggvevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdml
    pcysvariplpnlnedltcgnilmweavtlktevigvtslmnvhsngqathdngagkpvq
    gtsfhffsvggealelqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypv
    ecwvpdptrnentryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavd
    vcgmftnrsgsqqwrglsryfkvqlrkrrvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nxgA (A:)
    vevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdmlpcysva
    riplpnlnilmweavtlktevigvtslmnvhsngqathdngagkpvqgtsfhffsvggea
    lelqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnent
    ryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsqq
    wrglsryfkvqlrkrrvkn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nxgB (B:)
    gshmggvevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdml
    pcysvariplpnlnedltcgnilmweavtlktevigvtslmnvhsngqathdngagkpvq
    gtsfhffsvggealelqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypv
    ecwvpdptrnentryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavd
    vcgmftnrsgsqqwrglsryfkvqlrkrrvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nxgB (B:)
    vevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdmlpcysva
    riplpnlnilmweavtlktevigvtslmnvhsngqathdngagkpvqgtsfhffsvggea
    lelqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnent
    ryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsqq
    wrglsryfkvqlrkrrvk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3nxgC (C:)
    gshmggvevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdml
    pcysvariplpnlnedltcgnilmweavtlktevigvtslmnvhsngqathdngagkpvq
    gtsfhffsvggealelqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypv
    ecwvpdptrnentryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavd
    vcgmftnrsgsqqwrglsryfkvqlrkrrvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nxgC (C:)
    evlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdmlpcysvar
    iplpnlilmweavtlktevigvtslmnvhsngqathdngagkpvqgtsfhffsvggeale
    lqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnentry
    fgtltggenvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsqqwr
    glsryfkvqlrkrrvkn
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3nxgD (D:)
    gshmggvevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdml
    pcysvariplpnlnedltcgnilmweavtlktevigvtslmnvhsngqathdngagkpvq
    gtsfhffsvggealelqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypv
    ecwvpdptrnentryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavd
    vcgmftnrsgsqqwrglsryfkvqlrkrrvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nxgD (D:)
    vevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdmlpcysva
    riplpnlilmweavtlktevigvtslmnvhsngqathdngagkpvqgtsfhffsvggeal
    elqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnentr
    yfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsqqw
    rglsryfkvqlrkrrvkn
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3nxgE (E:)
    gshmggvevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdml
    pcysvariplpnlnedltcgnilmweavtlktevigvtslmnvhsngqathdngagkpvq
    gtsfhffsvggealelqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypv
    ecwvpdptrnentryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavd
    vcgmftnrsgsqqwrglsryfkvqlrkrrvkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nxgE (E:)
    vevlevktgvdsitevecfltpemgdpdehlrgfsksisisdtfesdspnrdmlpcysva
    riplpnlnilmweavtlktevigvtslmnvhsngqathdngagkpvqgtsfhffsvggea
    lelqgvlfnyrtkypdgtifpknatvqsqvmntehkayldknkaypvecwvpdptrnent
    ryfgtltggenvppvlhitntattvlldefgvgplckgdnlylsavdvcgmftnrsgsqq
    wrglsryfkvqlrkrrvkn