PDB entry 3nxe

View 3nxe on RCSB PDB site
Description: X-ray structure of ester chemical analogue 'covalent dimer' [Ile50,O-Ile50']HIV-1 protease complexed with MVT-101 inhibitor
Deposited on 2010-07-13, released 2011-11-02
The last revision was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 1.61 Å
R-factor: 0.186
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protease covalent dimer
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3NXE (0-202)
  • Heterogens: 2NC, SO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3nxeA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvieelnlpgcwkpkliggiggfikvrqyd
    qipveiaghkaigtvlvgptpvniigrnlltqigatlnfcggggpqitlwkrplvtirig
    gqlkealldtgaddtvieelnlpgcwkpkliggxggfikvrqydqipveiaghkaigtvl
    vgptpvniigrnlltqigatlnf