PDB entry 3nxc

View 3nxc on RCSB PDB site
Description: Molecular mechanism by which the Escherichia coli nucleoid occlusion factor, SlmA, keeps cytokinesis in check
Deposited on 2010-07-13, released 2011-02-23
The last revision was dated 2011-02-23, with a file datestamp of 2011-02-18.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.224
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HTH-type protein slmA
    Species: Escherichia coli [TaxId:83333]
    Gene: ttk, APECO1_2820, Ecok1_36180
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nxcA (A:)
    mppgkclfsgvfcnmaekqtakrnrreeilqslalmlessdgsqrittaklaasvgvsea
    alyrhfpsktrmfdsliefiedslitrinlilkdekdttarlrlivllllgfgernpglt
    riltghalmfeqdrlqgrinqlferieaqlrqvlrekrmregegyatdetllasqilafc
    egmlsrfvrsefkyrptddfdarwpliaaqlq
    

    Sequence, based on observed residues (ATOM records):
    >3nxcA (A:)
    rnrreeilqslalmlesittaklaasvgvseaalyrhfpsktrmfdsliefiedslitri
    nlilkdekdttarlrlivllllgfgernpgltriltgharlqgrinqlferieaqlrqvl
    rekrmreggyatdetllasqilafcegmlsrfvrsefkyrptddfdarwpliaaqlq