PDB entry 3nxb

View 3nxb on RCSB PDB site
Description: Crystal Structure of the Bromodomain of human CECR2
Class: transcription
Keywords: Structural Genomics Consortium, SGC, CECR2, cat eye syndrome chromosome region candidate 2, bromodomain, structural genomics, TRANSCRIPTION
Deposited on 2010-07-13, released 2010-08-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-11, with a file datestamp of 2012-04-06.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: 0.178
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cat eye syndrome critical region protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CECR2, KIAA1740
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nxba_
  • Chain 'B':
    Compound: Cat eye syndrome critical region protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CECR2, KIAA1740
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nxbb_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nxbA (A:)
    smreekktkdlfeldddftamykvldvvkahkdswpflepvdesyapnyyqiikapmdis
    smekklngglyctkeefvndmktmfrncrkyngesseytkmsdnlercfhrammkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nxbA (A:)
    dddftamykvldvvkahkdswpflepvdesyapnyyqiikapmdissmekklngglyctk
    eefvndmktmfrncrkyngesseytkmsdnlercfhrammk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nxbB (B:)
    smreekktkdlfeldddftamykvldvvkahkdswpflepvdesyapnyyqiikapmdis
    smekklngglyctkeefvndmktmfrncrkyngesseytkmsdnlercfhrammkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nxbB (B:)
    ddftamykvldvvkahkdswpflepvdesyapnyyqiikapmdissmekklngglyctke
    efvndmktmfrncrkyngesseytkmsdnlercfhrammk