PDB entry 3nx8

View 3nx8 on RCSB PDB site
Description: human cAMP dependent protein kinase in complex with phenol
Class: transferase
Keywords: TRANSFERASE, ATP Binding, Phosphorylation
Deposited on 2010-07-13, released 2011-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-02-15, with a file datestamp of 2012-02-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.22
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-dependent protein kinase catalytic subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: Pkaca, Prkaca
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nx8a_
  • Chain 'B':
    Compound: cAMP-dependent protein kinase inhibitor alpha
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IPH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nx8A (A:)
    mgnaaaakkgseqesvkeflakakedflkkwespaqntahldqferiktlgtgsfgrvml
    vkhketgnhyamkildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymv
    meyvpggemfshlrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgy
    iqvtdfgfakrvkgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppff
    adqpiqiyekivsgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndixnhkwfat
    tdwiaiyqrkveapfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nx8A (A:)
    vkeflakakedflkkwespaqntahldqferiktlgtgsfgrvmlvkhketgnhyamkil
    dkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlrr
    igrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgr
    twtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgk
    vrfpshfssdlkdllrnllqvdltkrfgnlkngvndixnhkwfattdwiaiyqrkveapf
    ipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
    

  • Chain 'B':
    No sequence available.