PDB entry 3nx7

View 3nx7 on RCSB PDB site
Description: Crystal structure of the catalytic domain of human MMP12 complexed with the inhibitor N-Hydroxy-2-(N-(2-hydroxyethyl)4-methoxyphenylsulfonamido)acetamide
Class: hydrolase
Keywords: matrix metalloproteinase, mmp12, elastase, complex (elastase-inhibitor), hydrolase
Deposited on 2010-07-13, released 2010-07-28
The last revision prior to the SCOPe 2.01 freeze date was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.166
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Macrophage metalloelastase
  Species: Homo sapiens [TaxId:9606]
  Gene: HME, MMP12
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39900 (0-157)
    • engineered mutation (65)
  Domains in SCOPe 2.01: d3nx7a_
• Heterogens: ZN, CA, NHK, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3nx7A (A:)
  gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
  gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
  lghssdpkavmfptykyvdintfrlsaddirgiqslyg