PDB entry 3nx7

View 3nx7 on RCSB PDB site
Description: Crystal structure of the catalytic domain of human MMP12 complexed with the inhibitor N-Hydroxy-2-(N-(2-hydroxyethyl)4-methoxyphenylsulfonamido)acetamide
Class: hydrolase
Keywords: matrix metalloproteinase, mmp12, elastase, complex (elastase-inhibitor), hydrolase
Deposited on 2010-07-13, released 2010-07-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: HME, MMP12
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (0-157)
      • engineered mutation (65)
    Domains in SCOPe 2.07: d3nx7a_
  • Heterogens: ZN, CA, NHK, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3nx7A (A:)
    gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
    gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
    lghssdpkavmfptykyvdintfrlsaddirgiqslyg