PDB entry 3nx6

View 3nx6 on RCSB PDB site
Description: Crystal Structure of co-chaperonin, GroES (Xoo4289) from Xanthomonas oryzae pv. oryzae KACC10331
Class: chaperone
Keywords: Bacterial blight, Xoo4289, GroES, Xanthomonas oryzae pv. oryzae KACC10331, CHAPERONE
Deposited on 2010-07-13, released 2010-07-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: 0.217
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 10kDa chaperonin
    Species: Xanthomonas oryzae pv. oryzae [TaxId:291331]
    Gene: Xoo4289
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5GUT0 (Start-94)
      • engineered mutation (54)
    Domains in SCOPe 2.08: d3nx6a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3nx6A (A:)
msikplhdrvvvkpieadevsaggivipdsakekstkgevvaigagkpldngslhapvvk
vgdkviygqyagssyksegveykvlreddilavig

    Sequence, based on observed residues (ATOM records): (download) 
    >3nx6A (A:)
sikplhdrvvvkpistkgevvaigagkpldngslhapvvkvgdkviygqyagssyksegv
eykvlreddilavig