PDB entry 3nx4

View 3nx4 on RCSB PDB site
Description: crystal structure of the yhdh oxidoreductase from salmonella enterica in complex with nadp
Deposited on 2010-07-12, released 2010-08-04
The last revision was dated 2017-11-08, with a file datestamp of 2017-11-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative oxidoreductase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:99287]
    Gene: yhdH, STM3376
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CPM2 (1-323)
      • initiating methionine (0)
  • Chain 'B':
    Compound: Putative oxidoreductase
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:99287]
    Gene: yhdH, STM3376
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7CPM2 (1-323)
      • initiating methionine (0)
  • Heterogens: NAP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3nx4A (A:)
    mqalileqqdgktlasvqhleesqlpagdvtvdvhwsslnykdalaitgkgkiirhfpmi
    pgidfagtvhasedprfhagqevlltgwgvgenhwgglaerarvkgdwlvalpaglssrn
    amiigtagftamlcvmaledagirpqdgevvvtgasggvgstavallhklgyqvaavsgr
    esthgylkslganrilsrdefaesrplekqlwagaidtvgdkvlakvlaqmnyggcvaac
    glaggfalpttvmpfilrnvrlqgvdsvmtpparraeawarlvkdlpesfyaqaateitl
    adapkfadaiinnqvqgrtlvkik
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3nx4B (B:)
    mqalileqqdgktlasvqhleesqlpagdvtvdvhwsslnykdalaitgkgkiirhfpmi
    pgidfagtvhasedprfhagqevlltgwgvgenhwgglaerarvkgdwlvalpaglssrn
    amiigtagftamlcvmaledagirpqdgevvvtgasggvgstavallhklgyqvaavsgr
    esthgylkslganrilsrdefaesrplekqlwagaidtvgdkvlakvlaqmnyggcvaac
    glaggfalpttvmpfilrnvrlqgvdsvmtpparraeawarlvkdlpesfyaqaateitl
    adapkfadaiinnqvqgrtlvkik