PDB entry 3nx3

View 3nx3 on RCSB PDB site
Description: Crystal structure of acetylornithine aminotransferase (argD) from Campylobacter jejuni
Class: transferase
Keywords: CSGID, Structural Genomics, Center for Structural Genomics of Infectious Diseases, 3-Layer(aba) Sandwich, acetylornithine aminotransferase, TRANSFERASE
Deposited on 2010-07-12, released 2010-08-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-11-17, with a file datestamp of 2010-11-12.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.155
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetylornithine aminotransferase
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: argD, Cj0227
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nx3a_
  • Chain 'B':
    Compound: Acetylornithine aminotransferase
    Species: Campylobacter jejuni subsp. jejuni [TaxId:192222]
    Gene: argD, Cj0227
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3nx3b_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nx3A (A:)
    mkmdykeqshiiptykrfdivlekgqgvylfddkakkyldfssgigvcalgynhakfnak
    ikaqvdkllhtsnlyyneniaaaaknlakasalervfftnsgtesiegamktarkyafnk
    gvkggqfiafkhsfhgrtlgalsltanekyqkpfkplisgvkfakyndissveklvnekt
    caiilesvqgegginpankdfykalrklcdekdilliadeiqcgmgrsgkffayehaqil
    pdimtsakalgcglsvgafvinqkvasnsleagdhgstyggnplvcagvnavfeifkeek
    ilenvnkltpyleqsldelinefdfckkrkglgfmqglsldksvkvakviqkcqenalll
    iscgendlrflpplilqkehidemseklrkalksf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nx3A (A:)
    qshiiptykrfdivlekgqgvylfddkakkyldfssgigvcalgynhakfnakikaqvdk
    llhtsnlyyneniaaaaknlakasalervfftnsgtesiegamktarkyafnkgvkggqf
    iafkhsfhgrtlgalsltanekyqkpfkplisgvkfakyndissveklvnektcaiiles
    vqgegginpankdfykalrklcdekdilliadeiqcgmgrsgkffayehaqilpdimtsa
    kalgcglsvgafvinqkvasnsleagdhgstyggnplvcagvnavfeifkeekilenvnk
    ltpyleqsldelinefdfckkrkglgfmqglsldksvkvakviqkcqenallliscgend
    lrflpplilqkehidemseklrkalksf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nx3B (B:)
    mkmdykeqshiiptykrfdivlekgqgvylfddkakkyldfssgigvcalgynhakfnak
    ikaqvdkllhtsnlyyneniaaaaknlakasalervfftnsgtesiegamktarkyafnk
    gvkggqfiafkhsfhgrtlgalsltanekyqkpfkplisgvkfakyndissveklvnekt
    caiilesvqgegginpankdfykalrklcdekdilliadeiqcgmgrsgkffayehaqil
    pdimtsakalgcglsvgafvinqkvasnsleagdhgstyggnplvcagvnavfeifkeek
    ilenvnkltpyleqsldelinefdfckkrkglgfmqglsldksvkvakviqkcqenalll
    iscgendlrflpplilqkehidemseklrkalksf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nx3B (B:)
    krfdivlekgqgvylfddkakkyldfssgigvcalgynhakfnakikaqvdkllhtsnly
    yneniaaaaknlakasalervfftnsgtesiegamktarkyafnkgvkggqfiafkhsfh
    grtlgalsltanekyqkpfkplisgvkfakyndissveklvnektcaiilesvqgeggin
    pankdfykalrklcdekdilliadeiqcgmgrsgkffayehaqilpdimtsakalgcgls
    vgafvinqkvasnsleagdhgstyggnplvcagvnavfeifkeekilenvnkltpyleqs
    ldelinefdfckkrkglgfmqglsldksvkvakviqkcqenallliscgendlrflppli
    lqkehidemseklrkalksf