PDB entry 3nx2

View 3nx2 on RCSB PDB site
Description: Enterobacter sp. Px6-4 Ferulic Acid Decarboxylase in complex with substrate analogues
Class: lyase
Keywords: Ferulic acid, decarboxylase, 4-vinylguaiacol, catalytic mechanism, phenolic acid decarboxylase superfamily, LYASE
Deposited on 2010-07-12, released 2011-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-16, with a file datestamp of 2011-02-11.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.191
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferulic acid decarboxylase
    Species: Enterobacter sp. Px6-4 [TaxId:418698]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6F3U5
      • see remark 999 (25)
      • see remark 999 (33)
      • see remark 999 (36)
      • see remark 999 (54)
      • see remark 999 (104)
      • see remark 999 (121)
    Domains in SCOPe 2.07: d3nx2a_
  • Chain 'B':
    Compound: Ferulic acid decarboxylase
    Species: Enterobacter sp. Px6-4 [TaxId:418698]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C6F3U5
      • see remark 999 (25)
      • see remark 999 (33)
      • see remark 999 (36)
      • see remark 999 (54)
      • see remark 999 (104)
      • see remark 999 (121)
    Domains in SCOPe 2.07: d3nx2b_
  • Heterogens: FER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3nx2A (A:)
    mntfdkhdlsgfvgkhlvytydngwnyeiyvkndntidyrihsglvgnrwvkdqeayivr
    vgesiykiswteptgtdvslivnlgdslfhgtiffprwvmnnpeptvcfqndhiplmnsy
    reagpayptevidefatitfvrdcgannesviacaaselpknfpdnlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nx2A (A:)
    dkhdlsgfvgkhlvytydngwnyeiyvkndntidyrihsglvgnrwvkdqeayivrvges
    iykiswteptgtdvslivnlgdslfhgtiffprwvmnnpeptvcfqndhiplmnsyreag
    payptevidefatitfvrdcgannesviacaaselpknfpdn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3nx2B (B:)
    mntfdkhdlsgfvgkhlvytydngwnyeiyvkndntidyrihsglvgnrwvkdqeayivr
    vgesiykiswteptgtdvslivnlgdslfhgtiffprwvmnnpeptvcfqndhiplmnsy
    reagpayptevidefatitfvrdcgannesviacaaselpknfpdnlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3nx2B (B:)
    tfdkhdlsgfvgkhlvytydngwnyeiyvkndntidyrihsglvgnrwvkdqeayivrvg
    esiykiswteptgtdvslivnlgdslfhgtiffprwvmnnpeptvcfqndhiplmnsyre
    agpayptevidefatitfvrdcgannesviacaaselpknfpdn