PDB entry 3nx0

View 3nx0 on RCSB PDB site
Description: Hinge-loop mutation can be used to control 3D domain swapping and amyloidogenesis of human cystatin C
Class: hydrolase inhibitor
Keywords: cysteine protease inhibitor, 3D domain swapping, protein engineering, protein oligomerization, protein aggregation, amyloid, HYDROLASE INHIBITOR
Deposited on 2010-07-12, released 2010-12-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-03-02, with a file datestamp of 2011-02-25.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.181
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cystatin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: CST3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01034 (Start-119)
      • engineered mutation (56)
    Domains in SCOPe 2.03: d3nx0a_
  • Chain 'B':
    Compound: Cystatin-C
    Species: Homo sapiens [TaxId:9606]
    Gene: CST3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01034 (Start-119)
      • engineered mutation (56)
    Domains in SCOPe 2.03: d3nx0b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3nx0A (A:)
sspgkpprlvggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqinagv
nyfldvelgrttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda

    Sequence, based on observed residues (ATOM records): (download) 
    >3nx0A (A:)
gpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqinagvnyfldvelgrt
tctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3nx0B (B:)
sspgkpprlvggpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqinagv
nyfldvelgrttctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda

    Sequence, based on observed residues (ATOM records): (download) 
    >3nx0B (B:)
gpmdasveeegvrraldfavgeynkasndmyhsralqvvrarkqinagvnyfldvelgrt
tctktqpnldncpfhdqphlkrkafcsfqiyavpwqgtmtlskstcqda