PDB entry 3nwz

View 3nwz on RCSB PDB site
Description: Crystal Structure of BH2602 protein from Bacillus halodurans with CoA, Northeast Structural Genomics Consortium Target BhR199
Deposited on 2010-07-12, released 2010-09-08
The last revision was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 2.57 Å
R-factor: 0.233
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BH2602 protein
    Species: Bacillus halodurans [TaxId:86665]
    Gene: BH2602
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: BH2602 protein
    Species: Bacillus halodurans [TaxId:86665]
    Gene: BH2602
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: BH2602 protein
    Species: Bacillus halodurans [TaxId:86665]
    Gene: BH2602
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: BH2602 protein
    Species: Bacillus halodurans [TaxId:86665]
    Gene: BH2602
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, COA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nwzA (A:)
    mdkrlqqdrivdkmerflstaneeekdvlssivdgllakqerryatylasltqiesqere
    dgrfevrlpigplvnnplnmvhggitatlldtamgqmvnrqlpdgqsavtselnihyvkp
    gmgtylravasivhqgkqrivvegkvytdqgetvamgtgsffvlrsrglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nwzA (A:)
    ivdkmerflstaneeekdvlssivdgllakqerryatylasltqiesqeredgrfevrlp
    igplvnnplnmvhggitatlldtamgqmvnrqlpdgqsavtselnihyvkpgmgtylrav
    asivhqgkqrivvegkvytdqgetvamgtgsffvl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nwzB (B:)
    mdkrlqqdrivdkmerflstaneeekdvlssivdgllakqerryatylasltqiesqere
    dgrfevrlpigplvnnplnmvhggitatlldtamgqmvnrqlpdgqsavtselnihyvkp
    gmgtylravasivhqgkqrivvegkvytdqgetvamgtgsffvlrsrglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nwzB (B:)
    flstaneeekdvlssivdgllakqerryatylasltqiesqeredgrfevrlpigplvnn
    plnmvhggitatlldtamgqmvnrqlpdgqsavtselnihyvkpgmgtylravasivhqg
    kqrivvegkvytdqgetvamgtgsffvlrsr
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nwzC (C:)
    mdkrlqqdrivdkmerflstaneeekdvlssivdgllakqerryatylasltqiesqere
    dgrfevrlpigplvnnplnmvhggitatlldtamgqmvnrqlpdgqsavtselnihyvkp
    gmgtylravasivhqgkqrivvegkvytdqgetvamgtgsffvlrsrglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nwzC (C:)
    ivdkmerflstaneeekdvlssivdgllakqerryatylasltqiesdgrfevrlpigpl
    vnnplnmvhggitatlldtamgqmvnrqlpdgqsavtselnihyvkpgmgtylravasiv
    hqgkqrivvegkvytdqgetvamgtgsffvl
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >3nwzD (D:)
    mdkrlqqdrivdkmerflstaneeekdvlssivdgllakqerryatylasltqiesqere
    dgrfevrlpigplvnnplnmvhggitatlldtamgqmvnrqlpdgqsavtselnihyvkp
    gmgtylravasivhqgkqrivvegkvytdqgetvamgtgsffvlrsrglehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nwzD (D:)
    kmerfaneeekdvlssivdgllakqerryatylasltqiesqevrlpigplvnnplnmvh
    ggitatlldtamgqmvnrqlpdgqsavtselnihyvkpgmgtylravasivhqgkqrivv
    egkvytdqgetvamgtgsffvl