PDB entry 3nwx

View 3nwx on RCSB PDB site
Description: X-ray structure of ester chemical analogue [O-Ile50,O-Ile50']HIV-1 protease complexed with KVS-1 inhibitor
Deposited on 2010-07-12, released 2011-11-02
The last revision was dated 2012-01-11, with a file datestamp of 2012-01-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.205
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3NWX (0-98)
  • Chain 'B':
    Compound: Protease
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3NWX (0-98)
  • Heterogens: SO4, KVS, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3nwxA (A:)
    pqitlwkrplvtiriggqlkealldtgaddtvieelnlpgcwkpkliggxggfikvrqyd
    qipveiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3nwxB (B:)
    pqitlwkrplvtiriggqlkealldtgaddtvieelnlpgcwkpkliggxggfikvrqyd
    qipveiaghkaigtvlvgptpvniigrnlltqigatlnf