PDB entry 3nwu

View 3nwu on RCSB PDB site
Description: Substrate induced remodeling of the active site regulates HtrA1 activity
Deposited on 2010-07-11, released 2011-02-23
The last revision was dated 2011-03-30, with a file datestamp of 2011-03-25.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.174
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine protease HTRA1
    Species: Homo sapiens [TaxId:9606]
    Gene: HTRA, HTRA1, PRSS11
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Serine protease HTRA1
    Species: Homo sapiens [TaxId:9606]
    Gene: HTRA, HTRA1, PRSS11
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Serine protease HTRA1
    Species: Homo sapiens [TaxId:9606]
    Gene: HTRA, HTRA1, PRSS11
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nwuA (A:)
    mgqedpnslrhkynfiadvvekiapavvhielfrklpfskrevpvasgsgfivsedgliv
    tnahvvtnkhrvkvelkngatyeakikdvdekadialikidhqgklpvlllgrsselrpg
    efvvaigspfslqntvttgivsttqrggkelglrnsdmdyiqtdaiinygnsggplvnld
    gevigintlkvtagisfaipsdkikkflteshdrqakgklehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nwuA (A:)
    dpnslrhkynfiadvvekiapavvhielfrklpfskrevpvasgsgfivsedglivtnah
    vvtnkhrvkvelkngatyeakikdvdekadialikidhqgklpvlllgrsselrpgefvv
    aigspfslqntvttgivsttdyiqtdaiinygnsggplvnldgevigintlkvtagisfa
    ipsdkikkfl
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >3nwuB (B:)
    mgqedpnslrhkynfiadvvekiapavvhielfrklpfskrevpvasgsgfivsedgliv
    tnahvvtnkhrvkvelkngatyeakikdvdekadialikidhqgklpvlllgrsselrpg
    efvvaigspfslqntvttgivsttqrggkelglrnsdmdyiqtdaiinygnsggplvnld
    gevigintlkvtagisfaipsdkikkflteshdrqakgklehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nwuB (B:)
    dpnslrhkynfiadvvekiapavvhielfrvpvasgsgfivsedglivtnahvvtnkhrv
    kvelkngatyeakikdvdekadialikidhqgklpvlllgrsselrpgefvvaigspfsl
    qntvttgivsttmdyiqtdaiinygnsggplvnldgevigintlkvtagisfaipsdkik
    kfl
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >3nwuC (C:)
    mgqedpnslrhkynfiadvvekiapavvhielfrklpfskrevpvasgsgfivsedgliv
    tnahvvtnkhrvkvelkngatyeakikdvdekadialikidhqgklpvlllgrsselrpg
    efvvaigspfslqntvttgivsttqrggkelglrnsdmdyiqtdaiinygnsggplvnld
    gevigintlkvtagisfaipsdkikkflteshdrqakgklehhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >3nwuC (C:)
    slrhkynfiadvvekiapavvhielfrklpevpvasgsgfivsedglivtnahvvtnkhr
    vkvelkngatyeakikdvdekadialikidhqgklpvlllgrsselrpgefvvaigspfs
    lqntvttgivsttdyiqtdaiinygnsggplvnldgevigintlkvtagisfaipsdkik
    kfl