PDB entry 3nwr

View 3nwr on RCSB PDB site
Description: Crystal structure of a rubisco-like protein from Burkholderia fungorum
Deposited on 2010-07-10, released 2010-07-28
The last revision was dated 2010-07-28, with a file datestamp of 2010-07-23.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.174
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: A rubisco-like protein
    Species: Burkholderia fungorum [TaxId:134537]
    Database cross-references and differences (RAF-indexed):
    • PDB 3NWR
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nwrA (A:)
    msgmlqaravdedtleadylietpldparvadvmageqssgtfvrvanesdalrarsras
    vlrieeleaaarpslpnawlerqgtpgpwrraritlsfplanidanlptlaatvagnlyd
    lgevtgvrllslrlpasyrarfelprhgvagtraltdvkdrpmigtiikpnvglsaaeta
    alvrelceagvdfikddevcanpahaplaervravmsevrryrersgrpvmvafnitddl
    damrrhaelvereggscvmasinwcgfsaiqslrrttplvlhahrngygmmsrdpalgms
    fqayqtlwrlsgvdhmhvhglagkfaqsdaeviesardcatplaagcddavlpafssgqw
    agtvqatfdavrstdllfmsgggilahpdgpaagvtsvrqawaavqagtplpvyaehmpe
    lrralaffggra
    

    Sequence, based on observed residues (ATOM records):
    >3nwrA (A:)
    edtleadylietpldparvadvmageqssgarsrasvlrieeleaaarpslpnawlerqg
    tpgpwrraritlsfplanidanlptlaatvagnlydlgevtgvrllslrlpasyrarfel
    prhgvagtraltdvkdrpmigtiikpnvglsaaetaalvrelceagvdfikddevcanpa
    haplaervravmsevrryrersgrpvmvafnitddldamrrhaelvereggscvmasinw
    cgfsaiqslrrttplvlhahrngygmmsrdpalgmsfqayqtlwrlsgvdhmhvhglagk
    faqsdaeviesardcatplaagcddavlpafssgqwagtvqatfdavrstdllfmsgggi
    lahpdgpaagvtsvrqawaavqagtplpvyaehmpelrralaff