PDB entry 3nwp

View 3nwp on RCSB PDB site
Description: crystal structure of a 6-phosphogluconolactonase (sbal_2240) from shewanella baltica os155 at 1.40 a resolution
Deposited on 2010-07-09, released 2010-07-28
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phosphogluconolactonase
    Species: Shewanella baltica [TaxId:407976]
    Gene: Sbal223_2253
    Database cross-references and differences (RAF-indexed):
    • Uniprot B8E528 (1-232)
      • leader sequence (0)
  • Chain 'B':
    Compound: 6-phosphogluconolactonase
    Species: Shewanella baltica [TaxId:407976]
    Gene: Sbal223_2253
    Database cross-references and differences (RAF-indexed):
    • Uniprot B8E528 (1-232)
      • leader sequence (0)
  • Heterogens: GOL, P6G, PEG, PG4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3nwpA (A:)
    gmiketvfksfdtpsaleqqlaskiasqlqeavdargkaslvvsggstplklfqllsmks
    idwsdvyitladerwveadadasnerlvrehllqnrasnakfrglknmfstaeagadmaa
    eslsnfprpfdvvvlgmgndghtcswfpcsaelenalttqalcvatnpttaphgritlsk
    sailnsrqiylhlvgeqklsvyrqalesddvhampiravlaqrktpvdvfwsa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3nwpB (B:)
    gmiketvfksfdtpsaleqqlaskiasqlqeavdargkaslvvsggstplklfqllsmks
    idwsdvyitladerwveadadasnerlvrehllqnrasnakfrglknmfstaeagadmaa
    eslsnfprpfdvvvlgmgndghtcswfpcsaelenalttqalcvatnpttaphgritlsk
    sailnsrqiylhlvgeqklsvyrqalesddvhampiravlaqrktpvdvfwsa