PDB entry 3nwo

View 3nwo on RCSB PDB site
Description: crystal structure of proline iminopeptidase mycobacterium smegmatis
Deposited on 2010-07-09, released 2010-08-04
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: proline iminopeptidase
    Species: Mycobacterium smegmatis [TaxId:246196]
    Gene: MSMEG_2681
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MG, GOL, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3nwoA (A:)
    mahhhhhhmgtleantngpgsmlsrmpvssrtvpfgdhetwvqvttpenaqphalplivl
    hggpgmahnyvaniaaladetgrtvihydqvgcgnsthlpdapadfwtpqlfvdefhavc
    talgieryhvlgqswggmlgaeiavrqpsglvslaicnspasmrlwseaagdlraqlpae
    traaldrheaagtithpdylqaaaefyrrhvcrvvptpqdfadsvaqmeaeptvyhtmng
    pnefhvvgtlgdwsvidrlpdvtapvlviagehdeatpktwqpfvdhipdvrshvfpgts
    hcthlekpeefravvaqflhqhdlaadarv
    

    Sequence, based on observed residues (ATOM records):
    >3nwoA (A:)
    ssrtvpfgdhetwvqvttpenaqphalplivlhggpgmahnyvaniaaladetgrtvihy
    dqvgcgnsthlpdapadfwtpqlfvdefhavctalgieryhvlgqswggmlgaeiavrqp
    sglvslaicnspasmrlwseaagdlraqlpaetraaldrheaagtithpdylqaaaefyr
    rhvcrvvptpqdfadsvaqmeaeptvyhtmngpnefhvvgtlgdwsvidrlpdvtapvlv
    iagehdeatpktwqpfvdhipdvrshvfpgtshcthlekpeefravvaqflhqhdlaad